Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2607
Gene name
LocationContig_183:36784..38649
Strand+
Gene length (bp)1865
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 1.4E-15 167 548

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14192|AATR1_SCHPO Aromatic amino acid aminotransferase C56E4.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56E4.03 PE=3 SV=1 86 556 4.0E-132
sp|P53090|ARO8_YEAST Aromatic/aminoadipate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO8 PE=1 SV=1 88 557 1.0E-110
sp|Q9Y7S6|AATR3_SCHPO Aromatic amino acid aminotransferase C569.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.07 PE=3 SV=1 92 556 2.0E-107
sp|O94570|AATR2_SCHPO Aromatic amino acid aminotransferase C1773.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.13 PE=3 SV=1 93 557 3.0E-100
sp|Q8N5Z0|AADAT_HUMAN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens GN=AADAT PE=1 SV=2 91 556 5.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14192|AATR1_SCHPO Aromatic amino acid aminotransferase C56E4.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56E4.03 PE=3 SV=1 86 556 4.0E-132
sp|P53090|ARO8_YEAST Aromatic/aminoadipate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO8 PE=1 SV=1 88 557 1.0E-110
sp|Q9Y7S6|AATR3_SCHPO Aromatic amino acid aminotransferase C569.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.07 PE=3 SV=1 92 556 2.0E-107
sp|O94570|AATR2_SCHPO Aromatic amino acid aminotransferase C1773.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.13 PE=3 SV=1 93 557 3.0E-100
sp|Q8N5Z0|AADAT_HUMAN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens GN=AADAT PE=1 SV=2 91 556 5.0E-70
sp|Q54K00|AATR2_DICDI Aromatic amino acid aminotransferase DDB_G0287711 OS=Dictyostelium discoideum GN=DDB_G0287711 PE=3 SV=1 109 558 2.0E-68
sp|Q5E9N4|AADAT_BOVIN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Bos taurus GN=AADAT PE=2 SV=1 91 556 4.0E-67
sp|Q9WVM8|AADAT_MOUSE Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Mus musculus GN=Aadat PE=1 SV=1 91 556 3.0E-65
sp|Q64602|AADAT_RAT Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Aadat PE=1 SV=1 91 553 5.0E-64
sp|P38840|ARO9_YEAST Aromatic amino acid aminotransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO9 PE=1 SV=3 121 556 1.0E-49
sp|Q86AG8|AATR1_DICDI Aromatic amino acid aminotransferase DDB_G0272014 OS=Dictyostelium discoideum GN=DDB_G0272014 PE=3 SV=1 101 479 6.0E-46
sp|H3ZPL1|ARAT1_THELN Aromatic-amino-acid aminotransferase 1 OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=OCC_04335 PE=1 SV=1 91 558 3.0E-37
sp|P95957|Y104_SULSO Uncharacterized aminotransferase SSO0104 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0104 PE=3 SV=1 93 553 1.0E-34
sp|P96681|YDFD_BACSU Uncharacterized HTH-type transcriptional regulator YdfD OS=Bacillus subtilis (strain 168) GN=ydfD PE=3 SV=1 49 553 2.0E-33
sp|Q72LL6|LYSN_THET2 2-aminoadipate transaminase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lysN PE=1 SV=1 89 554 2.0E-30
sp|Q796Q6|YISV_BACSU Uncharacterized HTH-type transcriptional regulator YisV OS=Bacillus subtilis (strain 168) GN=yisV PE=3 SV=1 176 553 7.0E-22
sp|Q5HJR1|NORG_STAAC HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain COL) GN=norG PE=3 SV=2 287 480 8.0E-19
sp|Q2FKF1|NORG_STAA3 HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain USA300) GN=norG PE=3 SV=2 287 480 8.0E-19
sp|Q2G1P1|NORG_STAA8 HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain NCTC 8325) GN=norG PE=1 SV=2 287 480 8.0E-19
sp|Q7A875|NORG_STAAN HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain N315) GN=norG PE=3 SV=1 287 480 2.0E-18
sp|Q99XA5|NORG_STAAM HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norG PE=3 SV=1 287 480 2.0E-18
sp|Q2YUS3|NORG_STAAB HTH-type transcriptional regulator NorG OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=norG PE=3 SV=2 287 480 1.0E-17
sp|P39389|YJIR_ECOLI Uncharacterized HTH-type transcriptional regulator YjiR OS=Escherichia coli (strain K12) GN=yjiR PE=3 SV=1 171 552 1.0E-15
sp|P49309|MOCR_RHIML Probable rhizopine catabolism regulatory protein MocR OS=Rhizobium meliloti GN=mocR PE=3 SV=1 119 473 2.0E-13
sp|P10356|YEY2_YEAST Uncharacterized protein YER152C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER152C PE=1 SV=2 273 554 3.0E-13
sp|O07578|YHDI_BACSU Uncharacterized HTH-type transcriptional regulator YhdI OS=Bacillus subtilis (strain 168) GN=yhdI PE=3 SV=1 259 508 2.0E-11
sp|Q01856|Y3073_RHOS4 Uncharacterized HTH-type transcriptional regulator RHOS4_30730 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=RHOS4_30730 PE=3 SV=1 231 336 2.0E-10
sp|P77730|YDCR_ECOLI Uncharacterized HTH-type transcriptional regulator YdcR OS=Escherichia coli (strain K12) GN=ydcR PE=3 SV=1 209 553 5.0E-09
sp|D5AKX9|TAUR_RHOCB HTH-type transcriptional regulator TauR OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=tauR PE=1 SV=1 209 553 2.0E-08
sp|Q08792|YCXD_BACSU Uncharacterized HTH-type transcriptional regulator YcxD OS=Bacillus subtilis (strain 168) GN=ycxD PE=3 SV=1 204 420 3.0E-08
sp|O52815|HPGT_AMYOR (S)-3,5-dihydroxyphenylglycine transaminase OS=Amycolatopsis orientalis GN=hpgT PE=1 SV=1 292 397 2.0E-07
sp|P96663|YDEF_BACSU Uncharacterized HTH-type transcriptional regulator YdeF OS=Bacillus subtilis (strain 168) GN=ydeF PE=3 SV=2 214 399 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0019842 vitamin binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2607
MLSAIQAASRRVATHPRTFIGQLRQIYYSLIRRSSTQATPTSACDKEKTRISAIDQVLSRRARAGKLVAGVAAAS
DSDMFKGPQTGKPKALRWDEHLSPESLRRRPCTLKQAAKYLKKPGLISLGGGLPAGEHFPFDEIAFKVPMTAPFS
KKQIEDVTIAKYGGQHPDGVYDLSTALNYSQSTGSAQMMRFITEHTEIVYRPPYADWRVCQTIGSTGALEQALRM
FCDKDRGDSVLTEEFSFSTALETIAPLGIKAYGVAMDEQGLLPNAMDHMLSNWHQGTRGARKPHVLYTVPCGQNP
TGATQGLERRKAIYRVAQKHDIFILEDDPYYFLQMQPYRGRDNSELSVPAHVDQFLSSLLPSLVSMDVDGRVLRM
DSFSKVLAPGSRAGWVVGSEQVIERYQRHAEVASQGPSGFSQVILHKLIDETWGHQGYLEWLMHLGCEYTKKRNA
LLAACEDHLPRDIVSWNAPEAGMFMWLKVDYTQHARVKQQSLKAIEEEIFNACVAGGVLVARGSWFLTDKDKDAG
GLFFRVTFAAASVSAMNEAIKRFGQAVRASFGRD*
Coding >OphauB2|2607
ATGTTGTCAGCAATCCAAGCGGCCAGCCGTCGGGTCGCCACGCATCCTCGGACCTTTATTGGGCAACTTCGCCAA
ATCTACTATAGCCTGATTCGTCGTTCAAGCACCCAGGCTACTCCAACTTCAGCCTGTGACAAGGAAAAGACAAGA
ATCAGCGCCATTGACCAGGTCTTGTCCAGACGAGCCCGTGCTGGAAAACTTGTAGCTGGCGTTGCGGCGGCATCG
GATAGTGATATGTTCAAGGGCCCACAAACTGGCAAGCCCAAGGCGCTGCGATGGGATGAACATCTGAGTCCCGAA
AGCCTTCGCAGAAGGCCATGTACGCTCAAACAGGCAGCAAAGTATCTCAAAAAGCCTGGCTTGATATCCCTGGGT
GGCGGATTGCCAGCGGGCGAACACTTTCCCTTTGATGAGATAGCTTTCAAGGTTCCCATGACTGCTCCTTTCTCA
AAGAAGCAGATTGAAGATGTCACTATTGCAAAATACGGCGGGCAGCATCCAGACGGGGTATATGACTTATCGACG
GCGCTCAATTACTCTCAGTCCACCGGATCGGCGCAGATGATGCGCTTCATCACCGAGCATACCGAGATTGTATAC
AGGCCCCCATATGCTGACTGGCGTGTATGTCAGACGATAGGCAGCACCGGGGCTCTGGAACAGGCTCTGCGAATG
TTTTGCGACAAAGATCGTGGTGACTCTGTTCTCACAGAAGAGTTTAGCTTCTCGACAGCTCTTGAGACAATTGCT
CCTCTGGGAATCAAGGCCTATGGAGTGGCCATGGACGAACAGGGGCTGTTGCCCAATGCCATGGATCACATGCTA
AGCAACTGGCATCAAGGCACAAGAGGAGCGAGAAAACCTCATGTCTTGTATACAGTACCATGTGGTCAAAACCCC
ACGGGTGCGACACAAGGCCTTGAACGCCGAAAGGCTATTTATCGCGTTGCACAGAAACACGATATCTTCATCCTC
GAGGACGACCCGTATTATTTTCTGCAGATGCAACCGTACAGGGGCAGAGACAATAGTGAGCTGTCTGTTCCGGCA
CACGTGGACCAATTTTTGTCGTCGCTGCTGCCGTCTCTTGTCAGCATGGACGTCGATGGGCGCGTTTTACGTATG
GATTCCTTCTCCAAAGTACTGGCTCCTGGCTCGCGCGCGGGCTGGGTAGTAGGATCAGAGCAGGTTATTGAGCGA
TATCAACGGCATGCCGAGGTGGCCAGCCAAGGCCCCTCTGGCTTCTCCCAGGTCATTTTGCACAAACTGATTGAT
GAAACATGGGGCCATCAAGGCTACCTGGAATGGCTGATGCATTTGGGATGTGAGTACACGAAGAAGCGCAATGCG
CTGCTAGCGGCCTGCGAGGACCATCTCCCACGAGATATAGTCAGCTGGAATGCTCCCGAAGCAGGCATGTTTATG
TGGCTAAAGGTTGACTACACGCAACATGCAAGAGTCAAACAACAATCTCTCAAAGCCATTGAGGAAGAAATCTTC
AATGCCTGTGTTGCTGGCGGCGTCCTTGTTGCTCGAGGCTCTTGGTTCTTGACAGACAAGGACAAGGATGCTGGT
GGACTCTTTTTCCGCGTCACGTTTGCGGCCGCCAGTGTCAGTGCCATGAATGAGGCCATTAAGAGATTTGGGCAG
GCTGTGCGGGCCAGCTTTGGGAGGGACTGA
Transcript >OphauB2|2607
ATGTTGTCAGCAATCCAAGCGGCCAGCCGTCGGGTCGCCACGCATCCTCGGACCTTTATTGGGCAACTTCGCCAA
ATCTACTATAGCCTGATTCGTCGTTCAAGCACCCAGGCTACTCCAACTTCAGCCTGTGACAAGGAAAAGACAAGA
ATCAGCGCCATTGACCAGGTCTTGTCCAGACGAGCCCGTGCTGGAAAACTTGTAGCTGGCGTTGCGGCGGCATCG
GATAGTGATATGTTCAAGGGCCCACAAACTGGCAAGCCCAAGGCGCTGCGATGGGATGAACATCTGAGTCCCGAA
AGCCTTCGCAGAAGGCCATGTACGCTCAAACAGGCAGCAAAGTATCTCAAAAAGCCTGGCTTGATATCCCTGGGT
GGCGGATTGCCAGCGGGCGAACACTTTCCCTTTGATGAGATAGCTTTCAAGGTTCCCATGACTGCTCCTTTCTCA
AAGAAGCAGATTGAAGATGTCACTATTGCAAAATACGGCGGGCAGCATCCAGACGGGGTATATGACTTATCGACG
GCGCTCAATTACTCTCAGTCCACCGGATCGGCGCAGATGATGCGCTTCATCACCGAGCATACCGAGATTGTATAC
AGGCCCCCATATGCTGACTGGCGTGTATGTCAGACGATAGGCAGCACCGGGGCTCTGGAACAGGCTCTGCGAATG
TTTTGCGACAAAGATCGTGGTGACTCTGTTCTCACAGAAGAGTTTAGCTTCTCGACAGCTCTTGAGACAATTGCT
CCTCTGGGAATCAAGGCCTATGGAGTGGCCATGGACGAACAGGGGCTGTTGCCCAATGCCATGGATCACATGCTA
AGCAACTGGCATCAAGGCACAAGAGGAGCGAGAAAACCTCATGTCTTGTATACAGTACCATGTGGTCAAAACCCC
ACGGGTGCGACACAAGGCCTTGAACGCCGAAAGGCTATTTATCGCGTTGCACAGAAACACGATATCTTCATCCTC
GAGGACGACCCGTATTATTTTCTGCAGATGCAACCGTACAGGGGCAGAGACAATAGTGAGCTGTCTGTTCCGGCA
CACGTGGACCAATTTTTGTCGTCGCTGCTGCCGTCTCTTGTCAGCATGGACGTCGATGGGCGCGTTTTACGTATG
GATTCCTTCTCCAAAGTACTGGCTCCTGGCTCGCGCGCGGGCTGGGTAGTAGGATCAGAGCAGGTTATTGAGCGA
TATCAACGGCATGCCGAGGTGGCCAGCCAAGGCCCCTCTGGCTTCTCCCAGGTCATTTTGCACAAACTGATTGAT
GAAACATGGGGCCATCAAGGCTACCTGGAATGGCTGATGCATTTGGGATGTGAGTACACGAAGAAGCGCAATGCG
CTGCTAGCGGCCTGCGAGGACCATCTCCCACGAGATATAGTCAGCTGGAATGCTCCCGAAGCAGGCATGTTTATG
TGGCTAAAGGTTGACTACACGCAACATGCAAGAGTCAAACAACAATCTCTCAAAGCCATTGAGGAAGAAATCTTC
AATGCCTGTGTTGCTGGCGGCGTCCTTGTTGCTCGAGGCTCTTGGTTCTTGACAGACAAGGACAAGGATGCTGGT
GGACTCTTTTTCCGCGTCACGTTTGCGGCCGCCAGTGTCAGTGCCATGAATGAGGCCATTAAGAGATTTGGGCAG
GCTGTGCGGGCCAGCTTTGGGAGGGACTGA
Gene >OphauB2|2607
ATGTTGTCAGCAATCCAAGCGGCCAGCCGTCGGGTCGCCACGCATCCTCGGACCTTTATTGGGCAACTTCGCCAA
ATCTACTATAGCCTGATTCGTCGTTCAAGCACCCAGGCTACTCCAACTTCAGCCTGTGACAAGGAAAAGACAAGA
ATCAGCGCCATTGACCAGGTCTTGTCCAGACGAGCCCGTGCTGGAAAACTTGTAGCTGGCGTTGCGGCGGCATCG
GATAGTGATATGTTCAAGGGCCCAGTGAGTTGCGCTCTAGTAGTTATGGTACGCATTCCCAAACTAACATGTGTG
GAAACTCGAAGCAAACTGGCAAGCCCAAGGCGCTGCGATGGGATGGTGCGATGTGACTATTCATACTTGCCTCGC
ATCGTGCTGATACAGAAATCTGGGCAGAACATCTGAGTCCCGAAAGCCTTCGCAGAAGGCCATGTACGCTCAAAC
AGGCAGCAAAGTATCTCAAAAAGCCTGGCTTGATATCCCTGGGTGGCGGATTGCCAGCGGGCGAACACTTTCCCT
TTGATGAGATAGCTTTCAAGGTTCCCATGACTGCTCCTTTCTCAAAGAAGCAGATTGAAGATGTCACTATTGCAA
AATACGGCGGGCAGCATCCAGACGGGGTATATGACTTATCGACGGCGCTCAATTACTCTCAGTCCACCGGATCGG
CGCAGATGATGCGCTTCATCACCGAGCATACCGAGATTGTATACAGGCCCCCATATGCTGACTGGCGTGTATGTC
AGACGATAGGCAGCACCGGGGCTCTGGAACAGGCTCTGCGAATGTTTTGCGACAAAGATCGTGGTGACTCTGTTC
TCACAGAAGAGTTTAGCTTCTCGACAGCTCTTGAGACAATTGCTCCTCTGGGAATCAAGGCCTATGGAGTGGCCA
TGGACGAACAGGGGCTGTTGCCCAATGCCATGGATCACATGCTAAGCAACTGGCATCAAGGCACAAGAGGAGCGA
GAAAACCTCATGTCTTGTATACAGTACCATGTGGTCAAAACCCCACGGGTGCGACACAAGGCCTTGAACGCCGAA
AGGCTATTTATCGCGTTGCACAGAAACACGATATCTTCATCCTCGAGGACGACCCGTATTATTTTCTGCAGATGC
AACCGTACAGGGGCAGAGACAATAGTGAGCTGTCTGTTCCGGCACACGTGGACCAATTTTTGTCGTCGCTGCTGC
CGTCTCTTGTCAGCATGGACGTCGATGGGCGCGTTTTACGTATGGATTCCTTCTCCAAAGTACTGGCTCCTGGCT
CGCGCGCGGGCTGGGTAGTAGGATCAGAGCAGGTTATTGAGCGATATCAACGGCATGCCGAGGTGGCCAGCCAAG
GCCCCTCTGGCTTCTCCCAGGTCATTTTGCACAAACTGATTGATGAAACATGGGGCCATCAAGGCTACCTGGAAT
GGCTGATGCATTTGGGATGTGAGTACACGAAGAAGCGCAATGCGCTGCTAGCGGCCTGCGAGGACCATCTCCCAC
GAGATATAGTCAGCTGGAATGCTCCCGAAGCAGGCATGTTTGTAAGTTTATTAATTCAAAACTTAGATTCGCGGT
GCAGCTTGTTGCTGACGAGGGCTTTTGCAAAGATGTGGCTAAAGGTTGACTACACGCAACATGCAAGAGTCAAAC
AACAATCTCTCAAAGCCATTGAGGAAGAAATCTTCAATGCCTGTGTTGCTGGCGGCGTCCTTGTTGCTCGAGGCT
CTTGGTTCTTGACAGACAAGGACAAGGATGCTGGTGGACTCTTTTTCCGCGTCACGTTTGCGGCCGCCAGTGTCA
GTGCCATGAATGAGGCCATTAAGAGATTTGGGCAGGCTGTGCGGGCCAGCTTTGGGAGGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail