Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2592
Gene name
LocationContig_182:37761..39678
Strand+
Gene length (bp)1917
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.4E-25 50 451
PF00083 Sugar_tr Sugar (and other) transporter 1.0E-06 82 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 48 361 5.0E-24
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 55 361 1.0E-19
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 3 523 1.0E-16
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 3 343 4.0E-16
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 1 549 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 48 361 5.0E-24
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 55 361 1.0E-19
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 3 523 1.0E-16
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 3 343 4.0E-16
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 1 549 1.0E-14
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 49 454 3.0E-14
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 56 477 7.0E-14
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 27 265 3.0E-11
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 83 348 1.0E-10
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 83 367 1.0E-10
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 83 367 1.0E-10
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 82 348 2.0E-10
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 83 385 5.0E-08
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 83 348 2.0E-07
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 83 252 2.0E-07
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 78 384 3.0E-07
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 79 348 3.0E-07
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 6 567 5.0E-07
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 70 207 7.0E-07
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 82 227 2.0E-06
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 83 360 2.0E-06
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 83 360 2.0E-06
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 81 520 2.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 36 468 3.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 36 468 3.0E-06
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 43 454 3.0E-06
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 77 367 7.0E-06
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 82 361 8.0E-06
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 82 361 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0044425 membrane part No
GO:0005215 transporter activity No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 38 56 18
2 83 105 22
3 110 128 18
4 135 157 22
5 172 194 22
6 201 223 22
7 243 265 22
8 270 292 22
9 312 334 22
10 341 360 19
11 370 392 22
12 399 421 22
13 441 463 22
14 521 543 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2592
MQSHSHQTATEHSRLLPSRDAPHDAAAHGSDQESPPLLAPWRAVAVGLSLWLLIFLEATNMSGMAIIQGPVAHAL
DAPRRARWFTTSYLIATSSLAPLVGRLATIFSPRALAPLVAMLFALGSLVASQATNADVFILGRVLAGAAGGGVL
SLSVVFVVALSKPHTRGVCFGMATAGITAGVSFGAVVYGGLLPIIGWRPLFWIQAPIAMVLGLAIYQSAPMAMTA
PRSALTPHVSASVLKRLSQIDYLGALLLTLTIVLFLYGLAGDIQLMYIAISLVSLAAFISVEYLVAADPVIPLSV
LSSRGVLLTCLGQLGLMSARWSLLFYAPVFMLAVRGAAPAAAGSVLIPTNLGFVVGGVLAGSLHIRRPGSFWLPT
LVVFAAAAMSYLCLSLVASPSVALSALVVIVFFNGAATGAALNYSLAHLLHLSYPGTHYVTSSLHSTFRGLGSSF
GTSIGGGIFFRLLRTNLGRGFQVLDGSQDLSQSRKDLIVRLLAVPDAVFHGGLNLDERQVAITGYSFAIKGVWKA
AGVLVIVMVAVQALTGWTSPSAKSLSNGQEGAVQDSDETRGQGEE*
Coding >OphauB2|2592
ATGCAGTCTCATTCGCATCAGACAGCCACTGAACACTCTCGGCTGCTTCCATCTCGCGACGCGCCTCACGATGCA
GCTGCACATGGCTCGGACCAGGAGTCGCCTCCGCTTCTTGCTCCCTGGCGCGCTGTAGCTGTCGGGCTCTCGCTA
TGGCTGCTCATCTTTCTCGAGGCTACAAACATGTCTGGCATGGCCATTATTCAAGGCCCCGTTGCCCACGCCCTC
GATGCTCCACGACGCGCTCGCTGGTTCACCACGTCATACCTCATTGCCACGTCGTCTCTGGCGCCTCTTGTCGGC
CGCTTGGCCACCATCTTTAGCCCTCGCGCCCTTGCTCCTCTGGTAGCCATGCTCTTCGCCCTTGGAAGCCTCGTT
GCTTCGCAAGCCACCAACGCCGACGTCTTCATTCTTGGCCGAGTCTTGGCCGGTGCTGCAGGTGGCGGCGTGCTC
TCTCTATCCGTGGTATTTGTCGTTGCTCTTTCCAAGCCCCACACCCGTGGTGTCTGTTTCGGCATGGCTACCGCC
GGAATCACGGCCGGTGTCTCATTTGGAGCTGTGGTCTATGGTGGCTTGCTGCCCATCATTGGATGGCGACCCCTG
TTTTGGATCCAAGCACCTATTGCCATGGTTCTCGGTCTCGCCATCTATCAAAGTGCGCCCATGGCAATGACTGCC
CCCAGGTCGGCCTTGACGCCTCATGTGTCTGCCTCTGTCTTGAAGAGGTTGTCGCAAATCGATTATCTCGGCGCC
CTTCTTCTTACCCTTACAATTGTTCTCTTTCTTTACGGCCTCGCAGGTGATATTCAGCTCATGTACATTGCCATT
TCGCTCGTCTCTCTGGCCGCCTTTATCTCGGTCGAGTATCTCGTGGCTGCCGATCCAGTCATTCCCCTCTCAGTG
CTTTCCTCTCGTGGCGTTCTACTCACCTGTCTTGGTCAGCTCGGTCTCATGTCAGCCCGCTGGAGTCTTCTCTTT
TATGCACCCGTCTTCATGCTCGCCGTCCGTGGCGCTGCCCCAGCCGCTGCTGGCTCCGTCTTGATTCCCACAAAT
CTCGGTTTTGTTGTCGGCGGCGTACTCGCTGGCTCGCTACATATTCGCCGGCCCGGCTCCTTTTGGCTCCCCACT
CTTGTCGTCTTTGCCGCTGCTGCAATGTCGTATCTCTGCCTTTCCCTCGTGGCCTCGCCCTCGGTGGCCCTTTCC
GCCCTGGTTGTCATTGTCTTTTTCAATGGAGCTGCAACGGGTGCCGCTCTAAACTATAGCCTTGCCCATCTCCTT
CACCTGAGCTATCCTGGCACCCACTACGTCACGAGCAGCCTGCACTCCACCTTTCGAGGCCTTGGTAGTAGCTTT
GGCACCTCTATTGGCGGCGGCATATTTTTTCGCCTGTTGCGCACAAACCTTGGTCGCGGCTTCCAAGTCTTGGAT
GGCTCTCAAGACTTGTCGCAATCACGCAAAGACCTCATTGTTCGCCTGCTTGCTGTTCCCGATGCCGTCTTTCAT
GGCGGTCTAAACCTAGACGAGCGACAAGTCGCCATTACTGGTTACAGTTTTGCCATCAAGGGGGTGTGGAAGGCT
GCTGGCGTGCTTGTCATTGTCATGGTTGCCGTCCAGGCCTTGACGGGCTGGACAAGCCCAAGCGCAAAGTCTCTG
TCTAATGGCCAAGAAGGAGCAGTGCAAGACTCTGATGAGACAAGAGGCCAAGGGGAAGAGTAA
Transcript >OphauB2|2592
ATGCAGTCTCATTCGCATCAGACAGCCACTGAACACTCTCGGCTGCTTCCATCTCGCGACGCGCCTCACGATGCA
GCTGCACATGGCTCGGACCAGGAGTCGCCTCCGCTTCTTGCTCCCTGGCGCGCTGTAGCTGTCGGGCTCTCGCTA
TGGCTGCTCATCTTTCTCGAGGCTACAAACATGTCTGGCATGGCCATTATTCAAGGCCCCGTTGCCCACGCCCTC
GATGCTCCACGACGCGCTCGCTGGTTCACCACGTCATACCTCATTGCCACGTCGTCTCTGGCGCCTCTTGTCGGC
CGCTTGGCCACCATCTTTAGCCCTCGCGCCCTTGCTCCTCTGGTAGCCATGCTCTTCGCCCTTGGAAGCCTCGTT
GCTTCGCAAGCCACCAACGCCGACGTCTTCATTCTTGGCCGAGTCTTGGCCGGTGCTGCAGGTGGCGGCGTGCTC
TCTCTATCCGTGGTATTTGTCGTTGCTCTTTCCAAGCCCCACACCCGTGGTGTCTGTTTCGGCATGGCTACCGCC
GGAATCACGGCCGGTGTCTCATTTGGAGCTGTGGTCTATGGTGGCTTGCTGCCCATCATTGGATGGCGACCCCTG
TTTTGGATCCAAGCACCTATTGCCATGGTTCTCGGTCTCGCCATCTATCAAAGTGCGCCCATGGCAATGACTGCC
CCCAGGTCGGCCTTGACGCCTCATGTGTCTGCCTCTGTCTTGAAGAGGTTGTCGCAAATCGATTATCTCGGCGCC
CTTCTTCTTACCCTTACAATTGTTCTCTTTCTTTACGGCCTCGCAGGTGATATTCAGCTCATGTACATTGCCATT
TCGCTCGTCTCTCTGGCCGCCTTTATCTCGGTCGAGTATCTCGTGGCTGCCGATCCAGTCATTCCCCTCTCAGTG
CTTTCCTCTCGTGGCGTTCTACTCACCTGTCTTGGTCAGCTCGGTCTCATGTCAGCCCGCTGGAGTCTTCTCTTT
TATGCACCCGTCTTCATGCTCGCCGTCCGTGGCGCTGCCCCAGCCGCTGCTGGCTCCGTCTTGATTCCCACAAAT
CTCGGTTTTGTTGTCGGCGGCGTACTCGCTGGCTCGCTACATATTCGCCGGCCCGGCTCCTTTTGGCTCCCCACT
CTTGTCGTCTTTGCCGCTGCTGCAATGTCGTATCTCTGCCTTTCCCTCGTGGCCTCGCCCTCGGTGGCCCTTTCC
GCCCTGGTTGTCATTGTCTTTTTCAATGGAGCTGCAACGGGTGCCGCTCTAAACTATAGCCTTGCCCATCTCCTT
CACCTGAGCTATCCTGGCACCCACTACGTCACGAGCAGCCTGCACTCCACCTTTCGAGGCCTTGGTAGTAGCTTT
GGCACCTCTATTGGCGGCGGCATATTTTTTCGCCTGTTGCGCACAAACCTTGGTCGCGGCTTCCAAGTCTTGGAT
GGCTCTCAAGACTTGTCGCAATCACGCAAAGACCTCATTGTTCGCCTGCTTGCTGTTCCCGATGCCGTCTTTCAT
GGCGGTCTAAACCTAGACGAGCGACAAGTCGCCATTACTGGTTACAGTTTTGCCATCAAGGGGGTGTGGAAGGCT
GCTGGCGTGCTTGTCATTGTCATGGTTGCCGTCCAGGCCTTGACGGGCTGGACAAGCCCAAGCGCAAAGTCTCTG
TCTAATGGCCAAGAAGGAGCAGTGCAAGACTCTGATGAGACAAGAGGCCAAGGGGAAGAGTAA
Gene >OphauB2|2592
ATGCAGTCTCATTCGCATCAGACAGCCACTGAACACTCTCGGCTGCTTCCATCTCGCGACGCGCCTCACGATGCA
GCTGCACATGGCTCGGACCAGGAGTCGCCTCCGCTTCTTGCTCCCTGGCGCGCTGTAGCTGTCGGGCTCTCGCTA
TGGCTGCTCATCTTTCTCGAGGGTACTCTTCTTCTCCTCCCCTTGTCCCTTTTCTCTTTGCGCTGTTGAGCAGTC
GTGGAGCTTCGGCCTTGGGAGCTAACTGGTAAGCTACAAACATGTCTGGCATGGCCATTATTCAAGGCCCCGTTG
CCCACGCCCTCGATGCTCCACGACGCGCTCGCTGGTTCACCACGTCATACCTCATTGCCACGTCGTCTCTGGCGC
CTCTTGTCGGCCGCTTGGCCACCATCTTTAGCCCTCGCGCCCTTGCTCCTCTGGTAGCCATGCTCTTCGCCCTTG
GAAGCCTCGTTGCTTCGCAAGCCACCAACGCCGACGTCTTCATTCTTGGCCGAGTCTTGGCCGGTGCTGCAGGTG
GCGGCGTGCTCTCTCTATCCGTGGTATTTGTCGTTGCTCTTTCCAAGCCCCACACCCGTGGTGTCTGTTTCGGCA
TGGCTACCGCCGGAATCACGGCCGGTGTCTCATTTGGAGCTGTGGTCTATGGTGGCTTGCTGCCCATCATTGGAT
GGGTTCGTGATGCCTTTTTTTTTCTTCTTCTCACCATGCCATGATTGACTAATTCTCATCTGTCTAGCGACCCCT
GTTTTGGATCCAAGCACCTATTGCCATGGTTCTCGGTCTCGCCATCTATCAAAGTGCGCCCATGGCAATGACTGC
CCCCAGGTCGGCCTTGACGCCTCATGTGTCTGCCTCTGTCTTGAAGAGGTTGTCGCAAATCGATTATCTCGGCGC
CCTTCTTCTTGTACGTCATTCGACACCTTGCTCATGACACCTCTTGACTTTTGGCAATGACAGACCCTTACAATT
GTTCTCTTTCTTTACGGCCTCGCAGGTGATATTCAGCTCATGTACATTGCCATTTCGCTCGTCTCTCTGGCCGCC
TTTATCTCGGTCGAGTATCTCGTGGCTGCCGATCCAGTCATTCCCCTCTCAGTGCTTTCCTCTCGTGGCGTTCTA
CTCACCTGTCTTGGTCAGCTCGGTCTCATGTCAGCCCGCTGGAGTCTTCTCTTTTATGCACCCGTCTTCATGCTC
GCCGTCCGTGGCGCTGCCCCAGCCGCTGCTGGCTCCGTCTTGATTCCCACAAATCTCGGTTTTGTTGTCGGCGGC
GTACTCGCTGGCTCGCTACATATTCGCCGGCCCGGCTCCTTTTGGCTCCCCACTCTTGTCGTCTTTGCCGCTGCT
GCAATGTCGTATCTCTGCCTTTCCCTCGTGGCCTCGCCCTCGGTGGCCCTTTCCGCCCTGGTTGTCATTGTCTTT
TTCAATGGAGCTGCAACGGGTGCCGCTCTAAACTATAGCCTTGCCCATCTCCTTCACCTGAGCTATCCTGGCACC
CACTACGTCACGAGCAGCCTGCACTCCACCTTTCGAGGCCTTGGTAGTAGCTTTGGCACCTCTATTGGCGGCGGC
ATATTTTTTCGCCTGTTGCGCACAAACCTTGGTCGCGGCTTCCAAGTCTTGGATGGCTCTCAAGACTTGTCGCAA
TCACGCAAAGACCTCATTGTTCGCCTGCTTGCTGTTCCCGATGCCGTCTTTCATGGCGGTCTAAACCTAGACGAG
CGACAAGTCGCCATTACTGGTTACAGTTTTGCCATCAAGGGGGTGTGGAAGGCTGCTGGCGTGCTTGTCATTGTC
ATGGTTGCCGTCCAGGCCTTGACGGGCTGGACAAGCCCAAGCGCAAAGTCTCTGTCTAATGGCCAAGAAGGAGCA
GTGCAAGACTCTGATGAGACAAGAGGCCAAGGGGAAGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail