Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2591
Gene name
LocationContig_182:35098..37060
Strand-
Gene length (bp)1962
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 8.0E-39 11 348
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.1E-14 12 235
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 9.4E-12 15 218
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.7E-06 15 68
PF13434 K_oxygenase L-lysine 6-monooxygenase (NADPH-requiring) 5.3E-06 95 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 10 547 2.0E-30
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 11 458 6.0E-30
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 11 547 2.0E-29
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 10 539 2.0E-29
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 11 547 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 10 547 2.0E-30
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 11 458 6.0E-30
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 11 547 2.0E-29
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 10 539 2.0E-29
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 11 547 2.0E-29
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 10 539 5.0E-29
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 10 347 7.0E-29
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 10 539 4.0E-28
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 10 543 5.0E-28
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 10 348 5.0E-27
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 11 547 1.0E-26
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 10 539 5.0E-26
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 10 539 6.0E-26
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 10 347 8.0E-26
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 11 566 8.0E-26
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 10 347 1.0E-25
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 10 449 1.0E-25
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 10 347 2.0E-25
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 10 347 2.0E-25
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 10 560 7.0E-25
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 10 347 1.0E-24
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 10 539 1.0E-24
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 12 556 2.0E-24
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 10 347 5.0E-24
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 11 539 1.0E-23
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 11 547 2.0E-23
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 10 560 3.0E-22
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 12 539 1.0E-20
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 10 246 2.0E-20
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 10 539 4.0E-20
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 11 347 4.0E-20
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 10 539 6.0E-20
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 10 539 6.0E-20
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 11 391 1.0E-19
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 11 348 1.0E-18
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 11 391 3.0E-18
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 2 218 3.0E-16
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 11 391 4.0E-16
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 11 347 2.0E-14
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 1 208 7.0E-14
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 1 208 2.0E-13
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 13 405 3.0E-13
sp|Q9HFE4|FMO1_SCHPO Thiol-specific monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmo1 PE=1 SV=1 8 230 7.0E-13
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 15 356 1.0E-12
sp|Q9FWW6|GSXL1_ARATH Flavin-containing monooxygenase FMO GS-OX-like 1 OS=Arabidopsis thaliana GN=At1g12160 PE=2 SV=1 13 201 3.0E-12
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 8 201 7.0E-12
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 10 201 8.0E-12
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 15 347 3.0E-11
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 8 215 3.0E-11
sp|Q9FWW3|GSXL6_ARATH Flavin-containing monooxygenase FMO GS-OX-like 6 OS=Arabidopsis thaliana GN=At1g12130 PE=2 SV=1 7 201 1.0E-10
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 13 201 2.0E-10
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 1 201 3.0E-10
sp|Q00730|STCW_EMENI Putative sterigmatocystin biosynthesis monooxygenase stcW OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcW PE=3 SV=2 12 225 1.0E-09
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 7 211 2.0E-09
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 15 391 3.0E-09
sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 13 204 6.0E-09
sp|Q9FWW9|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2 OS=Arabidopsis thaliana GN=At1g12200 PE=2 SV=1 1 234 1.0E-08
sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 12 201 3.0E-08
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 12 211 5.0E-08
sp|Q9C8T8|GSXLX_ARATH Putative flavin-containing monooxygenase FMO GS-OX-like 10 OS=Arabidopsis thaliana GN=At1g63340 PE=5 SV=3 1 243 1.0E-07
sp|Q9SXD9|GSXL7_ARATH Flavin-containing monooxygenase FMO GS-OX-like 7 OS=Arabidopsis thaliana GN=At1g62580 PE=3 SV=2 1 188 3.0E-07
sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 1 220 7.0E-07
sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 1 201 7.0E-07
sp|Q8ENX4|FENR2_OCEIH Ferredoxin--NADP reductase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2351 PE=3 SV=1 13 223 7.0E-07
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 3 207 1.0E-06
sp|A1CLY7|CCSB_ASPCL Ketocytochalasin monooxygenase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsB PE=1 SV=1 3 230 2.0E-06
sp|Q94K43|GSOX2_ARATH Flavin-containing monooxygenase FMO GS-OX2 OS=Arabidopsis thaliana GN=FMOGS-OX2 PE=2 SV=1 1 222 6.0E-06
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 13 356 6.0E-06
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 13 356 6.0E-06
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 13 356 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0004497 monooxygenase activity No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0048037 cofactor binding No
GO:0008152 metabolic process No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0008150 biological_process No
GO:0050662 coenzyme binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2591
MASVHPPPPGNKVCVVGAGPIGLVTIKNLTEQGLAVTAFERDGGFGGTWLQSEVVDKPMALPTTVFMNGKNGTSY
TDFPMGDDYPAQLSARHLVKYFGEYASHFELQQYIVLHTAVIDVRRDEKDTTWLVQTRHMQTGEETRHAFDRVVI
ACGNFGRKRMRYMEAAHVFAGTVLHSCDVRDTVQYKGKNVLVVGGGPTAVDYVESLHRNGAATIYISHGGKFRFL
PESFRGYLWDDVYTLRTEMIISALAHMSQIIMFWIFDRIALLMCRLMFPALSFWPSFFDNIPNRQRQPHVFVFFN
DYFLSIVEQGQVEIKAAFGKFTGPRSVVLADGEQLDDVDAVIVCSGYHEVPMPLSGPGIPTDPALSPERSERLIK
SPYYDPKSPFPRLYHGLLSETWPESLACVGRLSVPRSTMVIYDVATMALASVWSGKHPLPEQAEMKRVIDARHDF
VISVLEKGPIIYTGITLDMSETYWWWNEAAGTGINERLGSWGLQGWKFWLTEPILYEMIMDGAFCPAVYRLFETG
KGRRAWPGARQTIVRVQQDARRSNRAWKQKVKREGIKKSRSWGEALFSLSHWRG*
Coding >OphauB2|2591
ATGGCCTCTGTGCATCCTCCACCGCCCGGCAACAAGGTCTGCGTCGTCGGGGCGGGACCGATAGGCCTTGTAACC
ATCAAGAACCTGACGGAGCAGGGCCTTGCTGTGACGGCGTTTGAACGAGATGGAGGCTTTGGCGGCACTTGGCTG
CAGTCCGAGGTGGTGGACAAGCCCATGGCTCTTCCCACCACTGTCTTTATGAATGGGAAAAACGGGACCTCATAC
ACTGATTTCCCCATGGGAGATGACTATCCCGCGCAGCTTTCGGCGAGACATCTCGTAAAGTACTTTGGCGAATAC
GCAAGCCATTTCGAGCTTCAACAGTACATAGTTTTACACACGGCCGTCATTGACGTCCGCCGTGACGAAAAGGAC
ACGACTTGGCTGGTGCAGACGCGCCACATGCAGACTGGCGAGGAAACACGGCATGCTTTTGATAGAGTCGTGATT
GCTTGTGGCAACTTTGGCCGCAAGCGCATGCGCTACATGGAGGCGGCCCATGTCTTTGCCGGCACAGTCTTGCAC
TCTTGCGATGTTCGTGACACGGTGCAGTACAAGGGCAAGAATGTCCTGGTTGTCGGCGGAGGCCCAACAGCCGTT
GACTATGTCGAGTCGCTTCACCGCAACGGCGCTGCCACCATTTACATTAGCCACGGCGGCAAATTTCGCTTTCTA
CCTGAATCTTTTCGTGGCTATCTTTGGGATGACGTCTATACCCTTCGCACCGAAATGATTATTAGCGCCCTAGCT
CACATGAGTCAAATCATCATGTTTTGGATATTTGACAGGATTGCCCTGCTAATGTGTAGACTAATGTTTCCCGCT
CTATCCTTTTGGCCCTCCTTTTTCGACAATATCCCCAACAGGCAGCGACAGCCACACGTCTTTGTTTTTTTCAAT
GACTACTTCCTCTCCATTGTCGAGCAAGGCCAGGTGGAGATCAAGGCAGCCTTTGGAAAATTCACCGGCCCTCGC
TCTGTCGTGTTGGCTGATGGAGAGCAGCTCGACGACGTGGATGCCGTTATTGTCTGTAGCGGCTACCACGAGGTC
CCCATGCCCCTGTCGGGCCCAGGCATCCCAACGGACCCGGCACTGTCACCGGAGCGAAGCGAAAGGCTAATCAAG
TCACCCTACTACGACCCCAAGAGCCCCTTTCCTCGCCTCTATCACGGCCTCTTGTCCGAAACCTGGCCCGAGTCA
CTGGCTTGCGTGGGGCGCTTATCGGTACCCAGATCGACCATGGTGATATACGACGTTGCCACAATGGCACTGGCC
AGCGTCTGGTCTGGCAAGCACCCACTTCCTGAGCAAGCAGAGATGAAGCGAGTCATTGATGCGCGTCATGATTTC
GTGATAAGCGTCTTGGAAAAGGGCCCCATTATCTACACGGGCATCACATTGGACATGTCGGAGACGTATTGGTGG
TGGAATGAGGCAGCAGGTACGGGCATCAATGAAAGGCTGGGCAGCTGGGGCCTCCAAGGATGGAAGTTTTGGTTG
ACGGAGCCCATTTTGTACGAGATGATTATGGATGGCGCCTTTTGCCCCGCTGTCTACCGGCTGTTTGAGACGGGC
AAAGGGCGAAGAGCCTGGCCTGGTGCGCGGCAGACGATTGTCAGGGTGCAACAAGATGCAAGAAGATCTAATCGG
GCCTGGAAGCAAAAGGTTAAGAGGGAAGGCATCAAAAAGTCGAGGTCATGGGGGGAAGCATTGTTCTCCTTGAGT
CACTGGAGGGGTTGA
Transcript >OphauB2|2591
ATGGCCTCTGTGCATCCTCCACCGCCCGGCAACAAGGTCTGCGTCGTCGGGGCGGGACCGATAGGCCTTGTAACC
ATCAAGAACCTGACGGAGCAGGGCCTTGCTGTGACGGCGTTTGAACGAGATGGAGGCTTTGGCGGCACTTGGCTG
CAGTCCGAGGTGGTGGACAAGCCCATGGCTCTTCCCACCACTGTCTTTATGAATGGGAAAAACGGGACCTCATAC
ACTGATTTCCCCATGGGAGATGACTATCCCGCGCAGCTTTCGGCGAGACATCTCGTAAAGTACTTTGGCGAATAC
GCAAGCCATTTCGAGCTTCAACAGTACATAGTTTTACACACGGCCGTCATTGACGTCCGCCGTGACGAAAAGGAC
ACGACTTGGCTGGTGCAGACGCGCCACATGCAGACTGGCGAGGAAACACGGCATGCTTTTGATAGAGTCGTGATT
GCTTGTGGCAACTTTGGCCGCAAGCGCATGCGCTACATGGAGGCGGCCCATGTCTTTGCCGGCACAGTCTTGCAC
TCTTGCGATGTTCGTGACACGGTGCAGTACAAGGGCAAGAATGTCCTGGTTGTCGGCGGAGGCCCAACAGCCGTT
GACTATGTCGAGTCGCTTCACCGCAACGGCGCTGCCACCATTTACATTAGCCACGGCGGCAAATTTCGCTTTCTA
CCTGAATCTTTTCGTGGCTATCTTTGGGATGACGTCTATACCCTTCGCACCGAAATGATTATTAGCGCCCTAGCT
CACATGAGTCAAATCATCATGTTTTGGATATTTGACAGGATTGCCCTGCTAATGTGTAGACTAATGTTTCCCGCT
CTATCCTTTTGGCCCTCCTTTTTCGACAATATCCCCAACAGGCAGCGACAGCCACACGTCTTTGTTTTTTTCAAT
GACTACTTCCTCTCCATTGTCGAGCAAGGCCAGGTGGAGATCAAGGCAGCCTTTGGAAAATTCACCGGCCCTCGC
TCTGTCGTGTTGGCTGATGGAGAGCAGCTCGACGACGTGGATGCCGTTATTGTCTGTAGCGGCTACCACGAGGTC
CCCATGCCCCTGTCGGGCCCAGGCATCCCAACGGACCCGGCACTGTCACCGGAGCGAAGCGAAAGGCTAATCAAG
TCACCCTACTACGACCCCAAGAGCCCCTTTCCTCGCCTCTATCACGGCCTCTTGTCCGAAACCTGGCCCGAGTCA
CTGGCTTGCGTGGGGCGCTTATCGGTACCCAGATCGACCATGGTGATATACGACGTTGCCACAATGGCACTGGCC
AGCGTCTGGTCTGGCAAGCACCCACTTCCTGAGCAAGCAGAGATGAAGCGAGTCATTGATGCGCGTCATGATTTC
GTGATAAGCGTCTTGGAAAAGGGCCCCATTATCTACACGGGCATCACATTGGACATGTCGGAGACGTATTGGTGG
TGGAATGAGGCAGCAGGTACGGGCATCAATGAAAGGCTGGGCAGCTGGGGCCTCCAAGGATGGAAGTTTTGGTTG
ACGGAGCCCATTTTGTACGAGATGATTATGGATGGCGCCTTTTGCCCCGCTGTCTACCGGCTGTTTGAGACGGGC
AAAGGGCGAAGAGCCTGGCCTGGTGCGCGGCAGACGATTGTCAGGGTGCAACAAGATGCAAGAAGATCTAATCGG
GCCTGGAAGCAAAAGGTTAAGAGGGAAGGCATCAAAAAGTCGAGGTCATGGGGGGAAGCATTGTTCTCCTTGAGT
CACTGGAGGGGTTGA
Gene >OphauB2|2591
ATGGCCTCTGTGCATCCTCCACCGCCCGGCAACAAGGTCTGCGTCGTCGGGGCGGGACCGATAGGCCTTGTAACC
ATCAAGAACCTGACGGAGCAGGGCCTTGCTGTGACGGCGTTTGAACGAGATGGAGGCTTTGGCGGCACTTGGCTG
CAGTCCGAGGTGGTGGACAAGCCCATGGCTCTTCCCACCACTGTCTTTATGAATGGGAAAAACGGGGTGAGTTTT
CTTTTTTCTTTTTTTTTTTTAAAAAAATTACAGAAAAAAAAACAATAGCAACAACTTGGTGTCCTGGCGTCATTG
ATATTGATAATCCATGCCAGACCTCATACACTGATTTCCCCATGGGAGATGGTAAGCAAAACCACAGCGACGCGC
TTGGCACTTGGACTGACTCTAGCCCCTTGTAGACTATCCCGCGCAGCTTTCGGCGAGACATCTCGTAAAGTACTT
TGGCGAATACGCAAGCCATTTCGAGCTTCAACAGTACATAGTTTTACACACGGCCGTCATTGACGTCCGCCGTGA
CGAAAAGGACACGACTTGGCTGGTGCAGACGCGCCACATGCAGACTGGCGAGGAAACACGGCATGCTTTTGATAG
AGTCGTGATTGCTTGTGGCAACTTTGGCCGCAAGCGCATGCGCTACATGGAGGCGGCCCATGTCTTTGCCGGCAC
AGTCTTGCACTCTTGCGATGTTCGTGACACGGTGCAGTACAAGGGCAAGAATGTCCTGGTTGTCGGCGGAGGCCC
AACAGCCGTTGACTATGTCGAGTCGCTTCACCGCAACGGCGCTGCCACCATTTACATTAGCCACGGCGGCAAATT
TCGCTTTGTTGGTCCTCCGTGTCTTTTGCCATGATGGCTTGCTGGCTTGGCTCTTGCTGACCGTGGCAGCTACCT
GAATCTTTTCGTGGCTATCTTTGGGATGACGTCTATACCCTTCGCACCGAAATGATTATTAGCGCCCTAGCTCAC
ATGAGTCAAATCATCATGTTTTGGATATTTGACAGGATTGCCCTGCTAATGTGTAGACTAATGTTTCCCGCTCTA
TCCTTTTGGCCCTCCTTTTTCGACAATATCCCCAACAGGCAGCGACAGCCACACGTCTTTGTTTTTTTCAATGAC
TACTTCCTCTCCATTGTCGAGCAAGGCCAGGTGGAGATCAAGGCAGCCTTTGGAAAATTCACCGGCCCTCGCTCT
GTCGTGTTGGCTGATGGAGAGCAGCTCGACGACGTGGATGCCGTTATTGTCTGTAGCGGCTACCACGAGGTCCCC
ATGCCCCTGTCGGGCCCAGGCATCCCAACGGACCCGGCACTGTCACCGGAGCGAAGCGAAAGGCTAATCAAGTCA
CCCTACTACGACCCCAAGAGCCCCTTTCCTCGCCTCTATCACGGCCTCTTGTCCGAAACCTGGCCCGAGTCACTG
GCTTGCGTGGGGCGCTTATCGGTACCCAGATCGACCATGGTGATATACGACGTTGCCACAATGGCACTGGCCAGC
GTCTGGTCTGGCAAGCACCCACTTCCTGAGCAAGCAGAGATGAAGCGAGTCATTGATGCGCGTCATGATTTCGTG
ATAAGCGTCTTGGAAAAGGGCCCCATTATCTACACGGGCATCACATTGGACATGTCGGAGACGTATTGGTGGTGG
AATGAGGCAGCAGGTACGGGCATCAATGAAAGGCTGGGCAGCTGGGGCCTCCAAGGATGGAAGTTTTGGTTGACG
GAGCCCATTTTGTACGAGATGATTATGGATGGCGCCTTTTGCCCCGCTGTCTACCGGCTGTTTGAGACGGGCAAA
GGGCGAAGAGCCTGGCCTGGTGCGCGGCAGACGATTGTCAGGGTGCAACAAGATGCAAGAAGATCTAATCGGGCC
TGGAAGCAAAAGGTTAAGAGGGAAGGCATCAAAAAGTCGAGGTCATGGGGGGAAGCATTGTTCTCCTTGAGTCAC
TGGAGGGGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail