Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2589
Gene name
LocationContig_182:28179..31139
Strand-
Gene length (bp)2960
Transcript length (bp)2862
Coding sequence length (bp)2862
Protein length (aa) 954

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.4E-10 495 828

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 419 819 6.0E-13
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 414 860 9.0E-11
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 414 860 9.0E-11
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 414 860 2.0E-09
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 414 597 2.0E-08

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 52 74 22
3 94 116 22
4 128 150 22
5 210 232 22
6 412 434 22
7 449 471 22
8 491 513 22
9 528 547 19
10 560 582 22
11 597 619 22
12 753 775 22
13 779 801 22
14 813 835 22
15 845 864 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2589
MATALDAQVPDRGPAVFAVTTATLVLASVFVGARIVCRHFIVRNVSWDDKIMALAWVFAFFLSFTIDLAAVNGLG
KKDADIPGDDWGTLRHCEYVFSILYNPALMGTKTSILIFYLRLAKNTQIVLRYASWVTLAVVNLSGLVLTFMNIF
QCTPIQAAWAADFHGPSTCIPLLTEFICAAPVNILTDLAILALPIPVLTGMRLPSRQKTILVITFALGIFVTIVD
VVRIYYLQRAITDVPTGTTSDPESRFGGEADFAWNASLSLMWSAVEVNVGMACACIPTLKPLILKLLPAMLHDPN
GTRTSSMSRGPMDPDMLRRGSMATGGAVAIKADEAFLADGDVPIKPVDFLTIPETAVIVGSSSRHASSDTATHAP
TSFTASSAPENGVFFGFVNMAKPKSMLRAGTAESLKYCTIVSILFFLWGLSYGLLNTLNNAVAAVNHMRTSQTLG
LTSAYFGGGYFFGPLLVGEWILRRDEHNRTKRHEKNEAEHVGGFKATFIVGLCIYGIGTIIFWPSAVTNSYGGFM
LSNFVVGFGLSVLEVGANSFMVLCGPAEYGETRLLVAQGIQGVGSVLSGLLAQKVFFKGISQDNMPNSMTLINVQ
WTYLGITLLCVILGLFFYYMPLPEVSDKELKRSASLLPSVDPKRRSIGGLELRTVSLILAVFTQWVYVASQESNS
IFFRGLLISIFPSQDARPKSEHVETPDRKYNPDRPPGISLPIPDYLLVGHSAFAVSRFLVGYLTYLSVSRPRLPQ
PRTYLSICVAICFICALLLVTVRPAKPDLLVIPVLFFFFAEGPIWPLIFALGLRGQGRRTKRAAAFITMGGSGPA
FFPFIMYSIARYGNVQRAYIVIMALQVAMMAYPAFLEVSRAARRLVDQRPDLRHGLPSDDTPLHEIIARREAHTD
VCDGQPSPGFLRRMSKGLDFGFGGAHKGSHPGGADHSADVSPRTSTADAARPV*
Coding >OphauB2|2589
ATGGCCACGGCTTTGGATGCACAAGTCCCGGATCGTGGGCCCGCCGTCTTTGCCGTCACAACTGCCACCTTGGTG
CTGGCCTCGGTCTTTGTTGGTGCTCGCATCGTCTGCCGCCACTTTATTGTCCGCAATGTTAGCTGGGACGACAAG
ATTATGGCCCTGGCCTGGGTCTTTGCTTTTTTCCTCTCCTTCACCATTGACTTGGCTGCCGTCAATGGCCTGGGT
AAAAAGGATGCCGATATCCCAGGCGACGACTGGGGTACTTTGCGCCACTGCGAATATGTCTTTTCCATTCTCTAC
AATCCGGCCCTCATGGGAACAAAAACCAGCATCCTCATCTTCTACCTCCGCCTTGCAAAGAATACCCAAATTGTG
CTGCGCTATGCCTCTTGGGTTACGCTCGCCGTTGTCAACCTCTCTGGCCTTGTCCTTACCTTTATGAACATTTTT
CAGTGCACCCCGATACAGGCAGCCTGGGCGGCTGACTTTCACGGGCCTTCAACCTGCATCCCGCTCCTCACAGAG
TTTATATGCGCTGCGCCAGTCAATATTCTTACTGATTTAGCTATTCTCGCTTTGCCCATTCCCGTGCTTACTGGC
ATGCGCTTGCCCTCGCGCCAAAAGACTATTCTCGTCATCACCTTTGCTCTTGGAATCTTCGTCACCATTGTCGAT
GTCGTTCGAATCTACTACCTGCAGCGCGCCATTACCGATGTGCCGACTGGCACCACGTCGGACCCCGAGTCTCGA
TTTGGCGGCGAGGCTGATTTCGCCTGGAATGCCTCCCTCTCTCTTATGTGGAGCGCCGTCGAGGTCAATGTGGGC
ATGGCTTGCGCCTGCATCCCTACCTTGAAACCCTTGATCCTCAAGCTTCTCCCCGCGATGCTTCATGATCCCAAC
GGTACCAGGACATCGAGCATGTCTCGCGGTCCCATGGATCCTGACATGCTCCGCCGCGGCAGCATGGCCACGGGA
GGTGCCGTCGCCATCAAGGCTGACGAGGCGTTTCTGGCCGACGGCGATGTCCCCATTAAACCTGTCGACTTTTTG
ACTATTCCTGAAACGGCGGTCATCGTCGGCAGTAGTTCGCGACATGCGAGCTCAGACACGGCCACGCATGCTCCC
ACTAGCTTCACCGCCTCTTCAGCTCCCGAAAATGGCGTCTTTTTTGGCTTTGTCAACATGGCCAAGCCCAAGAGC
ATGCTCAGGGCTGGCACGGCGGAATCTCTAAAGTACTGCACCATTGTCTCGATTTTATTTTTTCTATGGGGTCTT
TCCTATGGCCTCCTCAACACGCTTAATAACGCCGTTGCCGCTGTCAATCACATGCGAACATCACAGACCCTTGGT
CTCACCAGCGCCTACTTTGGCGGCGGCTACTTTTTTGGTCCCTTGCTTGTTGGCGAGTGGATACTGCGCCGCGAC
GAGCATAATCGGACCAAGCGCCATGAAAAGAATGAGGCTGAACACGTGGGAGGCTTCAAGGCGACCTTTATTGTC
GGCCTGTGCATCTATGGCATCGGCACCATCATCTTTTGGCCCTCGGCTGTGACAAACTCTTATGGCGGCTTCATG
CTGAGCAACTTTGTCGTGGGCTTTGGTCTCTCGGTCCTCGAGGTTGGTGCCAACTCATTCATGGTGCTCTGCGGG
CCGGCAGAATATGGCGAGACGCGCCTGCTGGTGGCGCAGGGCATTCAGGGCGTTGGCAGCGTCTTGAGTGGCTTG
CTAGCTCAAAAAGTCTTTTTCAAGGGCATTTCCCAGGATAATATGCCCAACAGCATGACTCTAATCAATGTGCAA
TGGACCTATCTCGGCATCACTCTGCTCTGCGTCATTCTTGGTCTCTTTTTTTACTACATGCCGCTGCCAGAGGTG
AGCGACAAGGAGTTGAAGCGATCGGCCAGTCTGTTGCCGTCTGTTGATCCTAAGCGGAGAAGCATTGGCGGCTTG
GAGCTGCGGACCGTGAGCTTGATATTGGCCGTCTTTACGCAGTGGGTCTATGTCGCCTCCCAGGAGAGCAACAGC
ATATTCTTTCGCGGCCTCCTTATTTCCATATTCCCGAGCCAAGACGCAAGGCCTAAAAGCGAGCACGTGGAGACG
CCAGACCGAAAGTACAATCCAGATCGACCCCCGGGCATCTCTCTGCCAATTCCCGACTACCTGCTGGTTGGCCAT
TCCGCCTTTGCCGTGTCGAGGTTTCTTGTCGGCTATCTCACCTATCTCTCCGTCTCGCGGCCGCGGCTGCCACAG
CCACGCACCTATCTTAGCATTTGCGTCGCCATTTGCTTCATTTGCGCCCTGTTGCTCGTTACCGTGCGGCCCGCC
AAGCCCGATCTTCTCGTCATTCCCGTCCTCTTCTTCTTCTTTGCCGAGGGGCCAATTTGGCCGTTAATATTTGCC
CTTGGTCTGCGCGGACAGGGCCGTCGGACCAAGCGCGCAGCGGCCTTTATCACCATGGGAGGCTCAGGCCCGGCC
TTTTTCCCCTTTATAATGTATAGCATTGCACGCTATGGCAACGTCCAGCGGGCCTATATTGTCATTATGGCGCTG
CAAGTGGCCATGATGGCGTATCCTGCCTTTCTCGAAGTGTCACGGGCGGCGCGGCGGCTTGTTGACCAGCGGCCC
GACTTGCGACACGGGCTGCCGAGCGACGACACGCCCTTGCACGAGATTATTGCGAGGCGCGAGGCACATACTGAT
GTGTGTGATGGGCAGCCGAGCCCGGGCTTCTTGCGCCGCATGTCCAAGGGACTCGACTTTGGCTTTGGCGGAGCG
CACAAGGGATCCCACCCGGGGGGTGCTGACCATAGTGCGGATGTTAGTCCGAGGACCAGTACGGCGGATGCGGCT
CGGCCTGTTTAA
Transcript >OphauB2|2589
ATGGCCACGGCTTTGGATGCACAAGTCCCGGATCGTGGGCCCGCCGTCTTTGCCGTCACAACTGCCACCTTGGTG
CTGGCCTCGGTCTTTGTTGGTGCTCGCATCGTCTGCCGCCACTTTATTGTCCGCAATGTTAGCTGGGACGACAAG
ATTATGGCCCTGGCCTGGGTCTTTGCTTTTTTCCTCTCCTTCACCATTGACTTGGCTGCCGTCAATGGCCTGGGT
AAAAAGGATGCCGATATCCCAGGCGACGACTGGGGTACTTTGCGCCACTGCGAATATGTCTTTTCCATTCTCTAC
AATCCGGCCCTCATGGGAACAAAAACCAGCATCCTCATCTTCTACCTCCGCCTTGCAAAGAATACCCAAATTGTG
CTGCGCTATGCCTCTTGGGTTACGCTCGCCGTTGTCAACCTCTCTGGCCTTGTCCTTACCTTTATGAACATTTTT
CAGTGCACCCCGATACAGGCAGCCTGGGCGGCTGACTTTCACGGGCCTTCAACCTGCATCCCGCTCCTCACAGAG
TTTATATGCGCTGCGCCAGTCAATATTCTTACTGATTTAGCTATTCTCGCTTTGCCCATTCCCGTGCTTACTGGC
ATGCGCTTGCCCTCGCGCCAAAAGACTATTCTCGTCATCACCTTTGCTCTTGGAATCTTCGTCACCATTGTCGAT
GTCGTTCGAATCTACTACCTGCAGCGCGCCATTACCGATGTGCCGACTGGCACCACGTCGGACCCCGAGTCTCGA
TTTGGCGGCGAGGCTGATTTCGCCTGGAATGCCTCCCTCTCTCTTATGTGGAGCGCCGTCGAGGTCAATGTGGGC
ATGGCTTGCGCCTGCATCCCTACCTTGAAACCCTTGATCCTCAAGCTTCTCCCCGCGATGCTTCATGATCCCAAC
GGTACCAGGACATCGAGCATGTCTCGCGGTCCCATGGATCCTGACATGCTCCGCCGCGGCAGCATGGCCACGGGA
GGTGCCGTCGCCATCAAGGCTGACGAGGCGTTTCTGGCCGACGGCGATGTCCCCATTAAACCTGTCGACTTTTTG
ACTATTCCTGAAACGGCGGTCATCGTCGGCAGTAGTTCGCGACATGCGAGCTCAGACACGGCCACGCATGCTCCC
ACTAGCTTCACCGCCTCTTCAGCTCCCGAAAATGGCGTCTTTTTTGGCTTTGTCAACATGGCCAAGCCCAAGAGC
ATGCTCAGGGCTGGCACGGCGGAATCTCTAAAGTACTGCACCATTGTCTCGATTTTATTTTTTCTATGGGGTCTT
TCCTATGGCCTCCTCAACACGCTTAATAACGCCGTTGCCGCTGTCAATCACATGCGAACATCACAGACCCTTGGT
CTCACCAGCGCCTACTTTGGCGGCGGCTACTTTTTTGGTCCCTTGCTTGTTGGCGAGTGGATACTGCGCCGCGAC
GAGCATAATCGGACCAAGCGCCATGAAAAGAATGAGGCTGAACACGTGGGAGGCTTCAAGGCGACCTTTATTGTC
GGCCTGTGCATCTATGGCATCGGCACCATCATCTTTTGGCCCTCGGCTGTGACAAACTCTTATGGCGGCTTCATG
CTGAGCAACTTTGTCGTGGGCTTTGGTCTCTCGGTCCTCGAGGTTGGTGCCAACTCATTCATGGTGCTCTGCGGG
CCGGCAGAATATGGCGAGACGCGCCTGCTGGTGGCGCAGGGCATTCAGGGCGTTGGCAGCGTCTTGAGTGGCTTG
CTAGCTCAAAAAGTCTTTTTCAAGGGCATTTCCCAGGATAATATGCCCAACAGCATGACTCTAATCAATGTGCAA
TGGACCTATCTCGGCATCACTCTGCTCTGCGTCATTCTTGGTCTCTTTTTTTACTACATGCCGCTGCCAGAGGTG
AGCGACAAGGAGTTGAAGCGATCGGCCAGTCTGTTGCCGTCTGTTGATCCTAAGCGGAGAAGCATTGGCGGCTTG
GAGCTGCGGACCGTGAGCTTGATATTGGCCGTCTTTACGCAGTGGGTCTATGTCGCCTCCCAGGAGAGCAACAGC
ATATTCTTTCGCGGCCTCCTTATTTCCATATTCCCGAGCCAAGACGCAAGGCCTAAAAGCGAGCACGTGGAGACG
CCAGACCGAAAGTACAATCCAGATCGACCCCCGGGCATCTCTCTGCCAATTCCCGACTACCTGCTGGTTGGCCAT
TCCGCCTTTGCCGTGTCGAGGTTTCTTGTCGGCTATCTCACCTATCTCTCCGTCTCGCGGCCGCGGCTGCCACAG
CCACGCACCTATCTTAGCATTTGCGTCGCCATTTGCTTCATTTGCGCCCTGTTGCTCGTTACCGTGCGGCCCGCC
AAGCCCGATCTTCTCGTCATTCCCGTCCTCTTCTTCTTCTTTGCCGAGGGGCCAATTTGGCCGTTAATATTTGCC
CTTGGTCTGCGCGGACAGGGCCGTCGGACCAAGCGCGCAGCGGCCTTTATCACCATGGGAGGCTCAGGCCCGGCC
TTTTTCCCCTTTATAATGTATAGCATTGCACGCTATGGCAACGTCCAGCGGGCCTATATTGTCATTATGGCGCTG
CAAGTGGCCATGATGGCGTATCCTGCCTTTCTCGAAGTGTCACGGGCGGCGCGGCGGCTTGTTGACCAGCGGCCC
GACTTGCGACACGGGCTGCCGAGCGACGACACGCCCTTGCACGAGATTATTGCGAGGCGCGAGGCACATACTGAT
GTGTGTGATGGGCAGCCGAGCCCGGGCTTCTTGCGCCGCATGTCCAAGGGACTCGACTTTGGCTTTGGCGGAGCG
CACAAGGGATCCCACCCGGGGGGTGCTGACCATAGTGCGGATGTTAGTCCGAGGACCAGTACGGCGGATGCGGCT
CGGCCTGTTTAA
Gene >OphauB2|2589
ATGGCCACGGCTTTGGATGCACAAGTCCCGGATCGTGGGCCCGCCGTCTTTGCCGTCACAACTGCCACCTTGGTG
CTGGCCTCGGTCTTTGTTGGTGCTCGCATCGTCTGCCGCCACTTTATTGTCCGCAATGTTAGCTGGGACGACAAG
ATTATGGCCCTGGCCTGGGTCTTTGCTTTTTTCCTCTCCTTCACCATTGACTTGGCTGCCGTCAATGGCCTGGGT
AAAAAGGATGCCGATATCCCAGGCGACGACTGGGGTACTTTGCGCCACTGCGAATATGTCTTTTCCATTCTCTAC
GTGAGTGGCGTTGAATCCTCTTTTTTTTTCCTTTTTTTTTCTTTTTTTTTGGCGGTGGGGGGCTTCATCCTCTTG
CTGGCAGCTAACCATGAGTCTAGAATCCGGCCCTCATGGGAACAAAAACCAGCATCCTCATCTTCTACCTCCGCC
TTGCAAAGAATACCCAAATTGTGCTGCGCTATGCCTCTTGGGTTACGCTCGCCGTTGTCAACCTCTCTGGCCTTG
TCCTTACCTTTATGAACATTTTTCAGTGCACCCCGATACAGGCAGCCTGGGCGGCTGACTTTCACGGGCCTTCAA
CCTGCATCCCGCTCCTCACAGAGTTTATATGCGCTGCGCCAGTCAATATTCTTACTGATTTAGCTATTCTCGCTT
TGCCCATTCCCGTGCTTACTGGCATGCGCTTGCCCTCGCGCCAAAAGACTATTCTCGTCATCACCTTTGCTCTTG
GAATCTTCGTCACCATTGTCGATGTCGTTCGAATCTACTACCTGCAGCGCGCCATTACCGATGTGCCGACTGGCA
CCACGTCGGACCCCGAGTCTCGATTTGGCGGCGAGGCTGATTTCGCCTGGAATGCCTCCCTCTCTCTTATGTGGA
GCGCCGTCGAGGTCAATGTGGGCATGGCTTGCGCCTGCATCCCTACCTTGAAACCCTTGATCCTCAAGCTTCTCC
CCGCGATGCTTCATGATCCCAACGGTACCAGGACATCGAGCATGTCTCGCGGTCCCATGGATCCTGACATGCTCC
GCCGCGGCAGCATGGCCACGGGAGGTGCCGTCGCCATCAAGGCTGACGAGGCGTTTCTGGCCGACGGCGATGTCC
CCATTAAACCTGTCGACTTTTTGACTATTCCTGAAACGGCGGTCATCGTCGGCAGTAGTTCGCGACATGCGAGCT
CAGACACGGCCACGCATGCTCCCACTAGCTTCACCGCCTCTTCAGCTCCCGAAAATGGCGTCTTTTTTGGCTTTG
TCAACATGGCCAAGCCCAAGAGCATGCTCAGGGCTGGCACGGCGGAATCTCTAAAGTACTGCACCATTGTCTCGA
TTTTATTTTTTCTATGGGGTCTTTCCTATGGCCTCCTCAACACGCTTAATAACGCCGTTGCCGCTGTCAATCACA
TGCGAACATCACAGACCCTTGGTCTCACCAGCGCCTACTTTGGCGGCGGCTACTTTTTTGGTCCCTTGCTTGTTG
GCGAGTGGATACTGCGCCGCGACGAGCATAATCGGACCAAGCGCCATGAAAAGAATGAGGCTGAACACGTGGGAG
GCTTCAAGGCGACCTTTATTGTCGGCCTGTGCATCTATGGCATCGGCACCATCATCTTTTGGCCCTCGGCTGTGA
CAAACTCTTATGGCGGCTTCATGCTGAGCAACTTTGTCGTGGGCTTTGGTCTCTCGGTCCTCGAGGTTGGTGCCA
ACTCATTCATGGTGCTCTGCGGGCCGGCAGAATATGGCGAGACGCGCCTGCTGGTGGCGCAGGGCATTCAGGGCG
TTGGCAGCGTCTTGAGTGGCTTGCTAGCTCAAAAAGTCTTTTTCAAGGGCATTTCCCAGGATAATATGCCCAACA
GCATGACTCTAATCAATGTGCAATGGACCTATCTCGGCATCACTCTGCTCTGCGTCATTCTTGGTCTCTTTTTTT
ACTACATGCCGCTGCCAGAGGTGAGCGACAAGGAGTTGAAGCGATCGGCCAGTCTGTTGCCGTCTGTTGATCCTA
AGCGGAGAAGCATTGGCGGCTTGGAGCTGCGGACCGTGAGCTTGATATTGGCCGTCTTTACGCAGTGGGTCTATG
TCGCCTCCCAGGAGAGCAACAGCATATTCTTTCGCGGCCTCCTTATTTCCATATTCCCGAGCCAAGACGCAAGGC
CTAAAAGCGAGCACGTGGAGACGCCAGACCGAAAGTACAATCCAGATCGACCCCCGGGCATCTCTCTGCCAATTC
CCGACTACCTGCTGGTTGGCCATTCCGCCTTTGCCGTGTCGAGGTTTCTTGTCGGCTATCTCACCTATCTCTCCG
TCTCGCGGCCGCGGCTGCCACAGCCACGCACCTATCTTAGCATTTGCGTCGCCATTTGCTTCATTTGCGCCCTGT
TGCTCGTTACCGTGCGGCCCGCCAAGCCCGATCTTCTCGTCATTCCCGTCCTCTTCTTCTTCTTTGCCGAGGGGC
CAATTTGGCCGTTAATATTTGCCCTTGGTCTGCGCGGACAGGGCCGTCGGACCAAGCGCGCAGCGGCCTTTATCA
CCATGGGAGGCTCAGGCCCGGCCTTTTTCCCCTTTATAATGTATAGCATTGCACGCTATGGCAACGTCCAGCGGG
CCTATATTGTCATTATGGCGCTGCAAGTGGCCATGATGGCGTATCCTGCCTTTCTCGAAGTGTCACGGGCGGCGC
GGCGGCTTGTTGACCAGCGGCCCGACTTGCGACACGGGCTGCCGAGCGACGACACGCCCTTGCACGAGATTATTG
CGAGGCGCGAGGCACATACTGATGTGTGTGATGGGCAGCCGAGCCCGGGCTTCTTGCGCCGCATGTCCAAGGGAC
TCGACTTTGGCTTTGGCGGAGCGCACAAGGGATCCCACCCGGGGGGTGCTGACCATAGTGCGGATGTTAGTCCGA
GGACCAGTACGGCGGATGCGGCTCGGCCTGTTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail