Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2585
Gene name
LocationContig_182:16466..17614
Strand+
Gene length (bp)1148
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13460 NAD_binding_10 NAD(P)H-binding 2.5E-07 10 150

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P52579|IFRH_TOBAC Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1 10 244 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2585
MQTIALLSVGNLGKYMCDELLADGRYQFIVISRQSYKGPFFEQRGIDVRRSDYTCDSILDILNDTSASTLISFNN
SDGATYIDVHRACLDACRKSNTCKRFIPSEFAGNIDHFPNSPSYFTESRVPFREILRQEKKVEWTILNNGWIMDY
CLPGEKKHMPSIPDEFPIDPDGWKACIRGTGDEVQSFTSGQDIARALIRLLAVPKWEPTTYITGQWSTFNDMVAA
MEKFYGRPMPKTFRSQDDIHKDTLLPRTPENMQALYLASVEEMMLNAAGACPREKTLRQREEFFADMHFTRLEEL
LSEKAPRHVHDS*
Coding >OphauB2|2585
ATGCAAACCATAGCTTTGTTATCGGTGGGAAACCTGGGCAAATACATGTGCGACGAATTACTCGCCGACGGCCGC
TATCAATTCATTGTTATTTCGCGTCAGTCTTACAAGGGCCCCTTTTTCGAGCAGCGCGGAATAGACGTGCGCAGG
AGCGACTACACGTGCGACTCCATCCTCGACATTCTCAACGACACGAGCGCCAGCACCTTGATTTCCTTTAATAAC
AGCGATGGCGCGACATATATTGACGTGCACCGCGCCTGTCTCGACGCATGCCGCAAGTCAAATACGTGCAAACGC
TTCATCCCATCTGAATTCGCCGGCAACATTGACCACTTCCCCAATTCGCCCAGCTACTTTACCGAATCGCGAGTA
CCGTTTCGAGAAATTCTGCGCCAGGAAAAAAAAGTAGAGTGGACTATTTTGAATAATGGCTGGATCATGGATTAT
TGTTTGCCGGGAGAGAAGAAGCACATGCCGTCTATTCCTGATGAGTTTCCCATTGATCCGGATGGGTGGAAGGCG
TGTATTAGGGGGACGGGCGATGAGGTGCAGTCGTTTACAAGCGGGCAGGACATTGCGAGGGCGCTTATTAGGCTC
CTTGCTGTGCCGAAATGGGAACCCACGACGTATATTACCGGACAGTGGTCAACCTTTAACGACATGGTGGCGGCC
ATGGAAAAGTTTTATGGCCGACCCATGCCAAAAACATTTAGATCTCAAGATGATATCCATAAAGACACGCTCCTC
CCTCGCACCCCCGAAAACATGCAAGCCCTCTATCTTGCTAGTGTAGAGGAAATGATGCTCAATGCCGCAGGTGCA
TGCCCTCGAGAAAAGACGCTTCGTCAGCGCGAGGAATTCTTTGCAGACATGCACTTTACTCGGCTCGAGGAGCTC
TTGTCAGAAAAGGCGCCTCGACATGTGCACGATTCTTGA
Transcript >OphauB2|2585
ATGCAAACCATAGCTTTGTTATCGGTGGGAAACCTGGGCAAATACATGTGCGACGAATTACTCGCCGACGGCCGC
TATCAATTCATTGTTATTTCGCGTCAGTCTTACAAGGGCCCCTTTTTCGAGCAGCGCGGAATAGACGTGCGCAGG
AGCGACTACACGTGCGACTCCATCCTCGACATTCTCAACGACACGAGCGCCAGCACCTTGATTTCCTTTAATAAC
AGCGATGGCGCGACATATATTGACGTGCACCGCGCCTGTCTCGACGCATGCCGCAAGTCAAATACGTGCAAACGC
TTCATCCCATCTGAATTCGCCGGCAACATTGACCACTTCCCCAATTCGCCCAGCTACTTTACCGAATCGCGAGTA
CCGTTTCGAGAAATTCTGCGCCAGGAAAAAAAAGTAGAGTGGACTATTTTGAATAATGGCTGGATCATGGATTAT
TGTTTGCCGGGAGAGAAGAAGCACATGCCGTCTATTCCTGATGAGTTTCCCATTGATCCGGATGGGTGGAAGGCG
TGTATTAGGGGGACGGGCGATGAGGTGCAGTCGTTTACAAGCGGGCAGGACATTGCGAGGGCGCTTATTAGGCTC
CTTGCTGTGCCGAAATGGGAACCCACGACGTATATTACCGGACAGTGGTCAACCTTTAACGACATGGTGGCGGCC
ATGGAAAAGTTTTATGGCCGACCCATGCCAAAAACATTTAGATCTCAAGATGATATCCATAAAGACACGCTCCTC
CCTCGCACCCCCGAAAACATGCAAGCCCTCTATCTTGCTAGTGTAGAGGAAATGATGCTCAATGCCGCAGGTGCA
TGCCCTCGAGAAAAGACGCTTCGTCAGCGCGAGGAATTCTTTGCAGACATGCACTTTACTCGGCTCGAGGAGCTC
TTGTCAGAAAAGGCGCCTCGACATGTGCACGATTCTTGA
Gene >OphauB2|2585
ATGCAAACCATAGCTTTGTTATCGGTGGGAAACCTGGGCAAATACATGTGCGACGAATTACTCGCCGACGGCCGC
TATCAATTCATTGTTATTTCGCGTCAGGCAAGTTTTGCAACAAGTCTAGTTTTAACAGCGCTTATCCAGCTACAA
GGCGAATATTTATCCTTGCCAACCTGTAAACTAACACCAGAAACCTAGTCTTACAAGGGCCCCTTTTTCGAGCAG
CGCGGAATAGACGTGCGCAGGAGCGACTACACGTGCGACTCCATCCTCGACATTCTCAACGACACGAGCGCCAGC
ACCTTGATTTCCTTTAATAACAGCGATGGCGCGACATATATTGACGTGCACCGCGCCTGTCTCGACGCATGCCGC
AAGTCAAATACGTGCAAACGCTTCATCCCATCTGAATTCGCCGGCAACATTGACCACTTCCCCAATTCGCCCAGC
TACTTTACCGAATCGCGAGTACCGTTTCGAGAAATTCTGCGCCAGGAAAAAAAAGTAGAGTGGACTATTTTGAAT
AATGGCTGGATCATGGATTATTGTTTGCCGGGAGAGAAGAAGCACATGCCGTCTATTCCTGATGAGTTTCCCATT
GATCCGGATGGGTGGAAGGCGTGTATTAGGGGGACGGGCGATGAGGTGCAGTCGTTTACAAGCGGGCAGGACATT
GCGAGGGCGCTTATTAGGCTCCTTGCTGTGCCGAAATGGGTAAGACGTCTTGAGCCAAAGGGGGAAAATTGACTT
TTTGCTTAGACGATTTAGGAACCCACGACGTATATTACCGGACAGTGGTCAACCTTTAACGACATGGTGGCGGCC
ATGGAAAAGTTTTATGGTATAGTATATTATAACGTCTTGATTTTATCCATATCCTCGCAGCTAACATGGACTCAG
GCCGACCCATGCCAAAAACATTTAGATCTCAAGATGATATCCATAAAGACACGCTCCTCCCTCGCACCCCCGAAA
ACATGCAAGCCCTCTATCTTGCTAGTGTAGAGGAAATGATGCTCAATGCCGCAGGTGCATGCCCTCGAGAAAAGA
CGCTTCGTCAGCGCGAGGAATTCTTTGCAGACATGCACTTTACTCGGCTCGAGGAGCTCTTGTCAGAAAAGGCGC
CTCGACATGTGCACGATTCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail