Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2582
Gene name
LocationContig_182:11225..12458
Strand+
Gene length (bp)1233
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase superfamily 1.7E-24 167 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 20 302 3.0E-46
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 24 302 5.0E-43
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 13 319 1.0E-40
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 159 302 3.0E-37
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 158 317 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 20 302 3.0E-46
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 24 302 5.0E-43
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 13 319 1.0E-40
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 159 302 3.0E-37
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 158 317 3.0E-12
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 169 301 1.0E-10
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 158 310 1.0E-10
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 165 301 2.0E-10
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 171 301 6.0E-10
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 158 322 7.0E-10
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 158 315 9.0E-10
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 158 315 9.0E-10
sp|Q1LX59|C2512_DANRE Cholesterol 25-hydroxylase-like protein 1, member 2 OS=Danio rerio GN=ch25hl1.2 PE=3 SV=1 170 304 3.0E-09
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 170 324 4.0E-09
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 158 301 4.0E-09
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 171 301 5.0E-09
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 165 301 6.0E-09
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 169 301 3.0E-08
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 166 325 4.0E-08
sp|Q567X1|C25L1_DANRE Cholesterol 25-hydroxylase-like protein 1, member 1 OS=Danio rerio GN=ch25hl1.1 PE=2 SV=2 169 301 1.0E-07
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 164 345 4.0E-07
sp|Q4QQV7|CH25H_RAT Cholesterol 25-hydroxylase OS=Rattus norvegicus GN=Ch25h PE=2 SV=1 169 340 1.0E-06
sp|Q5PRC0|CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio GN=ch25h PE=2 SV=1 169 304 1.0E-06
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 165 326 2.0E-06
sp|Q9Z0F5|CH25H_MOUSE Cholesterol 25-hydroxylase OS=Mus musculus GN=Ch25h PE=1 SV=1 169 301 3.0E-06
sp|A8WGT1|C25L2_DANRE Cholesterol 25-hydroxylase-like protein 2 OS=Danio rerio GN=ch25hl2 PE=2 SV=1 171 321 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0005506 iron ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 155 177 22
2 226 248 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2582
MAHNQTSNSAPYTLTPKPPMVSGISDLHLSLLVPFAVHWLTSAVFELCERTGWLEQYRLHSSAEEQARNRVTRRD
CLRTTLQCQASPCAYCAAGPSEEYELATYIGGVEAAWAVGTRLLYPTGIDLKTLGSRLSKSLSRSAVTGLGQPAV
LVGSLLYWYIVPAFQFFFAIVVADAFMYCLHRLGHTNKWIYKHIHSQHHRLYVPYSWGGSYNHPFDSLVVDGLSY
ALGFWATGISNRLSIFLLGYASFKNVLDHAGYQFPWNPIAWATGMDASFHDVHHQSWGLKTNFGVHFGIWDRIMG
THFDNQELVANLRSRTRISAEEAAAHPEKTISSSINKERKGKGRRNEQD*
Coding >OphauB2|2582
ATGGCGCACAACCAGACATCCAACTCCGCTCCCTATACTCTCACTCCCAAGCCGCCCATGGTGTCGGGAATCTCG
GATCTGCATCTCTCGCTCCTTGTCCCCTTTGCCGTCCACTGGCTCACCTCGGCCGTCTTTGAGCTCTGCGAGCGC
ACTGGCTGGCTGGAGCAATATCGCCTGCATAGCTCGGCAGAGGAGCAGGCGAGAAACAGAGTGACGCGGCGTGAC
TGTCTGCGCACCACGCTTCAGTGTCAGGCAAGTCCATGTGCATACTGTGCTGCTGGGCCAAGTGAGGAGTATGAG
CTTGCTACATATATTGGTGGTGTTGAAGCAGCCTGGGCAGTAGGTACTAGGCTGCTCTACCCCACTGGCATCGAC
TTGAAGACGCTGGGCAGCAGGCTTTCCAAATCCTTGTCCCGCTCTGCAGTCACTGGACTCGGGCAGCCAGCGGTA
CTGGTAGGGAGCCTGCTGTACTGGTACATTGTGCCGGCCTTTCAGTTCTTCTTTGCCATTGTTGTTGCCGATGCC
TTTATGTACTGTCTTCACCGGCTGGGACATACAAACAAGTGGATCTATAAGCACATTCATTCGCAGCATCACCGG
CTCTACGTCCCATACTCATGGGGCGGCTCATACAACCATCCCTTTGACAGCCTCGTTGTTGACGGGCTTAGTTAT
GCTCTGGGCTTTTGGGCAACAGGCATCTCCAACAGGCTGTCCATTTTCCTCCTGGGCTATGCATCCTTTAAGAAT
GTGCTTGATCACGCGGGCTACCAGTTTCCGTGGAACCCGATAGCTTGGGCGACTGGGATGGATGCCTCGTTTCAC
GATGTACACCATCAAAGCTGGGGCTTAAAGACCAACTTTGGAGTGCATTTTGGCATATGGGATCGAATCATGGGG
ACGCACTTTGACAATCAAGAGCTTGTTGCAAATCTTCGCTCAAGGACTCGCATTTCCGCTGAAGAGGCTGCAGCT
CACCCCGAAAAGACAATTAGCAGCAGTATCAACAAGGAAAGAAAAGGCAAAGGGAGAAGAAATGAGCAAGACTGA
Transcript >OphauB2|2582
ATGGCGCACAACCAGACATCCAACTCCGCTCCCTATACTCTCACTCCCAAGCCGCCCATGGTGTCGGGAATCTCG
GATCTGCATCTCTCGCTCCTTGTCCCCTTTGCCGTCCACTGGCTCACCTCGGCCGTCTTTGAGCTCTGCGAGCGC
ACTGGCTGGCTGGAGCAATATCGCCTGCATAGCTCGGCAGAGGAGCAGGCGAGAAACAGAGTGACGCGGCGTGAC
TGTCTGCGCACCACGCTTCAGTGTCAGGCAAGTCCATGTGCATACTGTGCTGCTGGGCCAAGTGAGGAGTATGAG
CTTGCTACATATATTGGTGGTGTTGAAGCAGCCTGGGCAGTAGGTACTAGGCTGCTCTACCCCACTGGCATCGAC
TTGAAGACGCTGGGCAGCAGGCTTTCCAAATCCTTGTCCCGCTCTGCAGTCACTGGACTCGGGCAGCCAGCGGTA
CTGGTAGGGAGCCTGCTGTACTGGTACATTGTGCCGGCCTTTCAGTTCTTCTTTGCCATTGTTGTTGCCGATGCC
TTTATGTACTGTCTTCACCGGCTGGGACATACAAACAAGTGGATCTATAAGCACATTCATTCGCAGCATCACCGG
CTCTACGTCCCATACTCATGGGGCGGCTCATACAACCATCCCTTTGACAGCCTCGTTGTTGACGGGCTTAGTTAT
GCTCTGGGCTTTTGGGCAACAGGCATCTCCAACAGGCTGTCCATTTTCCTCCTGGGCTATGCATCCTTTAAGAAT
GTGCTTGATCACGCGGGCTACCAGTTTCCGTGGAACCCGATAGCTTGGGCGACTGGGATGGATGCCTCGTTTCAC
GATGTACACCATCAAAGCTGGGGCTTAAAGACCAACTTTGGAGTGCATTTTGGCATATGGGATCGAATCATGGGG
ACGCACTTTGACAATCAAGAGCTTGTTGCAAATCTTCGCTCAAGGACTCGCATTTCCGCTGAAGAGGCTGCAGCT
CACCCCGAAAAGACAATTAGCAGCAGTATCAACAAGGAAAGAAAAGGCAAAGGGAGAAGAAATGAGCAAGACTGA
Gene >OphauB2|2582
ATGGCGCACAACCAGACATCCAACTCCGCTCCCTATACTCTCACTCCCAAGCCGCCCATGGTGTCGGGAATCTCG
GATCTGCATCTCTCGCTCCTTGTCCCCTTTGCCGTCCACTGGCTCACCTCGGCCGTCTTTGAGCTCTGCGAGCGC
ACTGGCTGGCTGGAGCAATATCGCCTGCATAGCTCGGCAGAGGAGCAGGCGAGAAACAGAGTGACGCGGCGTGAC
TGTCTGCGCACCACGCTTCAGTGTCAGGCAAGTCCATGTGCATACTGTGCTGCTGGGCCAAGGTTTTTTTGCTCA
TAGTGGTAGGCTCTGCAAACTCTGCTTGGGCTGGTGTTGGGGGCGTTTGGAGAGGGTGACATGATGGGCAGTGAG
GAGTATGAGCTTGCTACATATATTGGTGGTGTTGAAGCAGCCTGGGCAGTAGGTACTAGGCTGCTCTACCCCACT
GGCATCGACTTGAAGACGCTGGGCAGCAGGCTTTCCAAATCCTTGTCCCGCTCTGCAGTCACTGGACTCGGGCAG
CCAGCGGTACTGGTAGGGAGCCTGCTGTACTGGTACATTGTGCCGGCCTTTCAGTTCTTCTTTGCCATTGTTGTT
GCCGATGCCTTTATGTACTGTCTTCACCGGCTGGGACATACAAACAAGTGGATCTATAGTAAGGCACAATGAGTC
GTGTCAAGGCTTGAGCTGACAAGTGGCAGAGCACATTCATTCGCAGCATCACCGGCTCTACGTCCCATACTCATG
GGGCGGCTCATACAACCATCCCTTTGACAGCCTCGTTGTTGACGGGCTTAGTTATGCTCTGGGCTTTTGGGCAAC
AGGCATCTCCAACAGGCTGTCCATTTTCCTCCTGGGCTATGCATCCTTTAAGAATGTGCTTGATCACGCGGGCTA
CCAGTTTCCGTGGAACCCGATAGCTTGGGCGACTGGGATGGATGCCTCGTTTCACGATGTACACCATCAAAGCTG
GGGCTTAAAGGCAAGTCTGTGTGCAGAGGTGGAGACGTGTTTGGCTGATTCTTTTACGAGTAGACCAACTTTGGA
GTGCATTTTGGCATATGGGATCGAATCATGGGGACGCACTTTGACAATCAAGAGCTTGTTGCAAATCTTCGCTCA
AGGACTCGCATTTCCGCTGAAGAGGCTGCAGCTCACCCCGAAAAGACAATTAGCAGCAGTATCAACAAGGAAAGA
AAAGGCAAAGGGAGAAGAAATGAGCAAGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail