Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2580
Gene name
LocationContig_182:7867..9051
Strand-
Gene length (bp)1184
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase superfamily 2.4E-20 159 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 13 296 7.0E-53
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 21 326 3.0E-51
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 26 293 1.0E-50
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 20 293 1.0E-39
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 157 317 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 13 296 7.0E-53
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 21 326 3.0E-51
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 26 293 1.0E-50
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 20 293 1.0E-39
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 157 317 3.0E-15
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 164 318 6.0E-15
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 164 317 1.0E-14
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 164 317 1.0E-14
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 27 319 4.0E-14
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 164 294 5.0E-14
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 44 321 3.0E-13
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 164 294 5.0E-13
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 164 322 8.0E-13
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 164 318 5.0E-12
sp|O59933|MSMO_CANAL Methylsterol monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG25 PE=3 SV=1 42 322 2.0E-11
sp|Q1EC69|SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana GN=SMO1-2 PE=2 SV=1 170 294 2.0E-11
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 153 312 2.0E-11
sp|F4JLZ6|SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana GN=SMO1-3 PE=2 SV=1 170 322 2.0E-11
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 49 294 8.0E-11
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 173 294 4.0E-10
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 173 320 7.0E-10
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 50 312 3.0E-09
sp|Q5PRC0|CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio GN=ch25h PE=2 SV=1 164 293 3.0E-07
sp|Q1LX59|C2512_DANRE Cholesterol 25-hydroxylase-like protein 1, member 2 OS=Danio rerio GN=ch25hl1.2 PE=3 SV=1 162 293 3.0E-07
sp|Q4G1G8|CH25H_PIG Cholesterol 25-hydroxylase OS=Sus scrofa GN=CH25H PE=2 SV=1 160 293 5.0E-07
sp|Q9Z0F5|CH25H_MOUSE Cholesterol 25-hydroxylase OS=Mus musculus GN=Ch25h PE=1 SV=1 160 293 7.0E-07
sp|Q4QQV7|CH25H_RAT Cholesterol 25-hydroxylase OS=Rattus norvegicus GN=Ch25h PE=2 SV=1 160 315 1.0E-06
sp|Q567X1|C25L1_DANRE Cholesterol 25-hydroxylase-like protein 1, member 1 OS=Danio rerio GN=ch25hl1.1 PE=2 SV=2 161 293 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0005506 iron ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2580
MADKQPVAPGPCPRPPLIPGISDQALSLVVPVATHWLTSAFYEVIQQFGFFEKYRIHSSREEDEKNIVGRLECLR
GVLTVQILQTALGVVIGALSEVEVTGAQDADLLAWEGRVQDVGKVIHTLVSACGLDVQLLCQAQVQRLVSKVIYH
GLIPALRFYVALWLADTWVFFIHRAEHCNTWIYKKFHAHHHELHVPYSWGGIYDHPLENLFLSVGAFALAVIGTG
MTLRESIFFSAFSSIKTCTDHGGYRFPWNPIDVLTTVDADYHDKHHQRWGLKTNFALHFQFWDRLLGTDFSDTQA
AARLYARDRKAAEMGADNKTRKMKVS*
Coding >OphauB2|2580
ATGGCAGACAAACAGCCTGTAGCGCCTGGGCCGTGCCCGAGACCGCCGCTCATACCGGGGATATCGGACCAGGCG
CTTTCCCTTGTTGTGCCTGTTGCGACACACTGGCTCACGTCGGCGTTTTACGAAGTTATCCAACAATTTGGCTTT
TTCGAAAAATACAGGATTCATTCTAGCCGTGAAGAAGACGAGAAGAATATTGTTGGAAGACTAGAATGTCTGCGC
GGCGTGCTCACAGTACAGATTTTGCAAACTGCCCTGGGAGTCGTTATTGGAGCATTGTCCGAGGTGGAAGTGACG
GGTGCGCAAGATGCCGACTTGTTGGCTTGGGAGGGCAGAGTACAAGACGTGGGAAAAGTAATTCACACTCTTGTC
TCGGCATGCGGCCTGGATGTCCAGCTATTATGCCAAGCTCAAGTGCAAAGACTTGTCTCCAAGGTTATTTACCAT
GGTCTCATTCCGGCGCTGCGGTTCTACGTGGCGCTATGGCTAGCAGATACCTGGGTATTCTTCATCCATCGAGCA
GAACACTGCAACACTTGGATATACAAAAAGTTTCACGCGCACCATCATGAGCTCCATGTGCCGTATAGCTGGGGC
GGGATTTACGACCACCCTCTCGAAAACCTATTCCTCAGTGTCGGCGCCTTTGCCCTCGCAGTGATTGGCACGGGC
ATGACGCTGCGGGAGAGCATCTTCTTCTCAGCCTTTTCATCGATAAAGACGTGTACTGACCACGGGGGATATCGA
TTTCCGTGGAACCCAATCGACGTGCTGACTACGGTCGATGCTGATTATCACGATAAACATCACCAGCGATGGGGT
TTAAAGACAAACTTTGCTCTTCATTTTCAGTTTTGGGACCGTCTCCTGGGAACAGACTTTTCGGATACGCAGGCT
GCAGCTAGGCTATATGCTCGAGATCGAAAGGCGGCAGAAATGGGCGCGGACAACAAGACGCGCAAGATGAAGGTT
TCCTAA
Transcript >OphauB2|2580
ATGGCAGACAAACAGCCTGTAGCGCCTGGGCCGTGCCCGAGACCGCCGCTCATACCGGGGATATCGGACCAGGCG
CTTTCCCTTGTTGTGCCTGTTGCGACACACTGGCTCACGTCGGCGTTTTACGAAGTTATCCAACAATTTGGCTTT
TTCGAAAAATACAGGATTCATTCTAGCCGTGAAGAAGACGAGAAGAATATTGTTGGAAGACTAGAATGTCTGCGC
GGCGTGCTCACAGTACAGATTTTGCAAACTGCCCTGGGAGTCGTTATTGGAGCATTGTCCGAGGTGGAAGTGACG
GGTGCGCAAGATGCCGACTTGTTGGCTTGGGAGGGCAGAGTACAAGACGTGGGAAAAGTAATTCACACTCTTGTC
TCGGCATGCGGCCTGGATGTCCAGCTATTATGCCAAGCTCAAGTGCAAAGACTTGTCTCCAAGGTTATTTACCAT
GGTCTCATTCCGGCGCTGCGGTTCTACGTGGCGCTATGGCTAGCAGATACCTGGGTATTCTTCATCCATCGAGCA
GAACACTGCAACACTTGGATATACAAAAAGTTTCACGCGCACCATCATGAGCTCCATGTGCCGTATAGCTGGGGC
GGGATTTACGACCACCCTCTCGAAAACCTATTCCTCAGTGTCGGCGCCTTTGCCCTCGCAGTGATTGGCACGGGC
ATGACGCTGCGGGAGAGCATCTTCTTCTCAGCCTTTTCATCGATAAAGACGTGTACTGACCACGGGGGATATCGA
TTTCCGTGGAACCCAATCGACGTGCTGACTACGGTCGATGCTGATTATCACGATAAACATCACCAGCGATGGGGT
TTAAAGACAAACTTTGCTCTTCATTTTCAGTTTTGGGACCGTCTCCTGGGAACAGACTTTTCGGATACGCAGGCT
GCAGCTAGGCTATATGCTCGAGATCGAAAGGCGGCAGAAATGGGCGCGGACAACAAGACGCGCAAGATGAAGGTT
TCCTAA
Gene >OphauB2|2580
ATGGCAGACAAACAGCCTGTAGCGCCTGGGCCGTGCCCGAGACCGCCGCTCATACCGGGGATATCGGACCAGGCG
CTTTCCCTTGTTGTGCCTGTTGCGACACACTGGCTCACGTCGGCGTTTTACGAAGTTATCCAACAATTTGGCTTT
TTCGAAAAATACAGGATTCATTCTAGCCGTGAAGAAGACGAGAAGAATATTGTTGGAAGACTAGAATGTCTGCGC
GGCGTGCTCACAGTACAGGTGTGATGTTCTTCCTAGCTGTGCCTTGAATACATCTTGACTCGAGTGTTGCAGATT
TTGCAAACTGCCCTGGGAGTCGTTATTGGAGCATTGTCCGAGGTGGAAGTGACGGGTGCGCAAGATGCCGACTTG
TTGGCTTGGGAGGGCAGAGTACAAGACGTGGGAAAAGTAATTCACACTCTTGTCTCGGCATGCGGCCTGGATGTC
CAGCTATTATGCCAAGCTCAAGTGCAAAGACTTGTCTCCAAGGTTATTTACCATGGTCTCATTCCGGCGCTGCGG
TTCTACGTGGCGCTATGGCTAGCAGATACCTGGGTATTCTTCATCCATCGAGCAGAACACTGCAACACTTGGATA
TACAGTAAGACGGCCTACCCTGAAGCCACAGCACCTAGACTAACGCAGACGAGTAGAAAAGTTTCACGCGCACCA
TCATGAGCTCCATGTGCCGTATAGCTGGGGCGGGATTTACGACCACCCTCTCGAAAACCTATTCCTCAGTGTCGG
CGCCTTTGCCCTCGCAGTGATTGGCACGGGCATGACGCTGCGGGAGAGCATCTTCTTCTCAGCCTTTTCATCGAT
AAAGACGTGTACTGACCACGGGGGATATCGATTTCCGTGGAACCCAATCGACGTGCTGACTACGGTCGATGCTGA
TTATCACGATAAACATCACCAGCGATGGGGTTTAAAGGTTAGTTGCTGCCCTTTGCGCCTCTTTTCGTACATTTC
TCTTGAGATTTCCTGTCAAGACGGCGTGGGCTAACTATTGTTGACATGACAAAAAAAAGACAAACTTTGCTCTTC
ATTTTCAGTTTTGGGACCGTCTCCTGGGAACAGACTTTTCGGATACGCAGGCTGCAGCTAGGCTATATGCTCGAG
ATCGAAAGGCGGCAGAAATGGGCGCGGACAACAAGACGCGCAAGATGAAGGTTTCCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail