Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2577
Gene name
LocationContig_182:3198..4298
Strand+
Gene length (bp)1100
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 6.7E-17 30 157
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.2E-07 36 157
PF08659 KR KR domain 3.3E-09 31 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 9 309 6.0E-20
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 29 322 9.0E-15
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 27 274 4.0E-14
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 19 245 7.0E-14
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 19 309 7.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 9 309 6.0E-20
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 29 322 9.0E-15
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 27 274 4.0E-14
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 19 245 7.0E-14
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 19 309 7.0E-13
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 23 285 3.0E-12
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 19 285 1.0E-11
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 24 309 2.0E-11
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 29 310 3.0E-11
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 11 321 3.0E-11
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 29 309 4.0E-11
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 19 321 5.0E-11
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 19 321 6.0E-11
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 1 313 6.0E-11
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 20 310 8.0E-11
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 1 313 9.0E-11
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 1 313 1.0E-10
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 26 274 2.0E-10
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 29 319 3.0E-10
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 29 309 5.0E-10
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 11 321 7.0E-10
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 29 309 3.0E-09
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 29 321 1.0E-08
sp|Q8W3D9|PORB_ORYSJ Protochlorophyllide reductase B, chloroplastic OS=Oryza sativa subsp. japonica GN=PORB PE=2 SV=1 18 157 2.0E-08
sp|Q42536|PORA_ARATH Protochlorophyllide reductase A, chloroplastic OS=Arabidopsis thaliana GN=PORA PE=1 SV=2 31 318 4.0E-08
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 25 152 1.0E-07
sp|O48741|PORC_ARATH Protochlorophyllide reductase C, chloroplastic OS=Arabidopsis thaliana GN=PORC PE=1 SV=1 19 121 1.0E-07
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 19 157 3.0E-07
sp|Q39617|POR_CHLRE Protochlorophyllide reductase, chloroplastic OS=Chlamydomonas reinhardtii GN=PORA PE=3 SV=1 30 121 3.0E-07
sp|Q5AV81|Y7799_EMENI Uncharacterized oxidoreductase AN7799 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7799 PE=1 SV=2 32 243 5.0E-07
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 30 259 9.0E-07
sp|O80333|POR_MARPA Protochlorophyllide reductase, chloroplastic OS=Marchantia paleacea GN=PORA PE=2 SV=1 18 157 1.0E-06
sp|P21218|PORB_ARATH Protochlorophyllide reductase B, chloroplastic OS=Arabidopsis thaliana GN=PORB PE=1 SV=3 19 121 4.0E-06
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 31 119 5.0E-06
sp|Q9SDT1|POR_DAUCA Protochlorophyllide reductase, chloroplastic OS=Daucus carota GN=POR1 PE=2 SV=1 31 121 7.0E-06
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 25 154 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2577
MVVPLPFLSGFIYRQLLLTPPQPTTRFDGQTIIITGATSGLGFEAARLFARLGAAHIILGARNVTQGEAAARAVA
QAASSKEALRVDVWELDLEKYASVREFAARVDGLERVDVVCQNAGMATGRFCLAEKDESTVTVNVVCAVLLTLLV
LPKLKESAARFGIHPVVTFSCSEIHHFYEFTQRNEPQILATLSDKSKASMLDRYFVSKLLQLLCVRELASRAGPA
YPVAINCFNPGFVQTRLGREFGWNLYLWGVVFARSARVGSRTLVAAAGAGAESHGKYMSEGEVAEPSEWVRSEEG
KRVQRRVWEEVVERVEGIVPGVSGNI*
Coding >OphauB2|2577
ATGGTCGTCCCCCTCCCCTTTCTCAGCGGCTTCATCTACCGCCAACTGCTCCTCACCCCTCCCCAGCCCACCACC
CGCTTCGACGGCCAAACCATAATCATCACGGGCGCCACCTCTGGTCTTGGCTTTGAAGCCGCCCGCCTCTTTGCC
CGTCTGGGCGCCGCGCACATTATCCTCGGCGCGCGCAACGTCACCCAGGGCGAGGCGGCAGCACGGGCGGTGGCG
CAGGCGGCCAGTAGCAAAGAAGCGCTACGTGTAGATGTCTGGGAGTTGGATCTGGAAAAGTATGCGTCGGTGAGG
GAGTTTGCGGCGCGGGTGGACGGGCTGGAGCGCGTGGATGTGGTGTGTCAGAATGCGGGTATGGCGACGGGGAGG
TTTTGTCTTGCGGAAAAGGATGAGAGTACGGTGACGGTGAATGTGGTGTGTGCGGTGTTGCTTACCTTGCTCGTG
CTGCCAAAGCTAAAAGAGTCGGCGGCGAGGTTTGGCATACATCCCGTGGTGACGTTTAGCTGTAGCGAGATTCAC
CACTTTTACGAATTTACCCAACGCAACGAGCCGCAAATCCTCGCCACCCTCTCCGACAAGAGCAAAGCCAGCATG
CTCGACCGCTACTTTGTCAGCAAGCTCCTCCAGCTACTATGCGTGCGCGAACTGGCCTCGCGCGCCGGCCCAGCC
TACCCCGTGGCCATCAACTGCTTCAACCCGGGCTTTGTGCAGACGCGGCTGGGCAGGGAGTTTGGCTGGAACTTG
TATCTCTGGGGCGTCGTGTTTGCGCGCTCGGCCCGCGTGGGCAGTCGGACGCTGGTGGCGGCGGCGGGGGCGGGC
GCAGAGTCGCATGGCAAGTATATGAGCGAGGGCGAGGTTGCGGAGCCGAGTGAGTGGGTGAGGAGCGAGGAAGGG
AAGAGGGTGCAGAGGAGAGTGTGGGAGGAGGTGGTGGAGAGGGTGGAGGGGATAGTGCCGGGGGTGAGTGGGAAT
ATTTAG
Transcript >OphauB2|2577
ATGGTCGTCCCCCTCCCCTTTCTCAGCGGCTTCATCTACCGCCAACTGCTCCTCACCCCTCCCCAGCCCACCACC
CGCTTCGACGGCCAAACCATAATCATCACGGGCGCCACCTCTGGTCTTGGCTTTGAAGCCGCCCGCCTCTTTGCC
CGTCTGGGCGCCGCGCACATTATCCTCGGCGCGCGCAACGTCACCCAGGGCGAGGCGGCAGCACGGGCGGTGGCG
CAGGCGGCCAGTAGCAAAGAAGCGCTACGTGTAGATGTCTGGGAGTTGGATCTGGAAAAGTATGCGTCGGTGAGG
GAGTTTGCGGCGCGGGTGGACGGGCTGGAGCGCGTGGATGTGGTGTGTCAGAATGCGGGTATGGCGACGGGGAGG
TTTTGTCTTGCGGAAAAGGATGAGAGTACGGTGACGGTGAATGTGGTGTGTGCGGTGTTGCTTACCTTGCTCGTG
CTGCCAAAGCTAAAAGAGTCGGCGGCGAGGTTTGGCATACATCCCGTGGTGACGTTTAGCTGTAGCGAGATTCAC
CACTTTTACGAATTTACCCAACGCAACGAGCCGCAAATCCTCGCCACCCTCTCCGACAAGAGCAAAGCCAGCATG
CTCGACCGCTACTTTGTCAGCAAGCTCCTCCAGCTACTATGCGTGCGCGAACTGGCCTCGCGCGCCGGCCCAGCC
TACCCCGTGGCCATCAACTGCTTCAACCCGGGCTTTGTGCAGACGCGGCTGGGCAGGGAGTTTGGCTGGAACTTG
TATCTCTGGGGCGTCGTGTTTGCGCGCTCGGCCCGCGTGGGCAGTCGGACGCTGGTGGCGGCGGCGGGGGCGGGC
GCAGAGTCGCATGGCAAGTATATGAGCGAGGGCGAGGTTGCGGAGCCGAGTGAGTGGGTGAGGAGCGAGGAAGGG
AAGAGGGTGCAGAGGAGAGTGTGGGAGGAGGTGGTGGAGAGGGTGGAGGGGATAGTGCCGGGGGTGAGTGGGAAT
ATTTAG
Gene >OphauB2|2577
ATGGTCGTCCCCCTCCCCTTTCTCAGCGGCTTCATCTACCGCCAACTGCTCCTCACCCCTCCCCAGCCCACCACC
CGCTTCGACGGCCAAACCATAATCATCACGGGCGCCACCTCTGGTCTTGGCTTTGAAGCCGCCCGCCTCTTTGCC
CGTCTGGGCGCCGCGCACATTATCCTCGGCGCGCGCAACGTCACCCAGGGCGAGGCGGCAGCACGGGCGGTGGCG
CAGGCGGCCAGTAGCAAAGAAGCGCTACGTGTAGATGTCTGGGAGTTGGATCTGGAAAAGTATGCGTCGGTGAGG
GAGTTTGCGGCGCGGGTGGACGGGCTGGAGCGCGTGGATGTGGTGTGTCAGAATGCGGGTATGGCGACGGGGAGG
TTTTGTCTTGCGGAAAAGGATGAGAGTACGGTGACGGTGAATGTGGTGTGTGCGGTGTTGCTTACCTTGCTCGTG
CTGCCAAAGCTAAAAGAGTCGGCGGCGAGGTTTGGCATACATCCCGTGGTGACGTTTAGCTGTAGCGAGATTGTA
AGTGTCTCTTTCCTCAACCCCCTTGATCTTTTTTGTTGCAATTTTCTCTCTTTTACGTCTTCTTTCTTGATTAAC
CTCGCTTTTTGAAATTTTCTCGACTTACACCTCTCCCCCAGCACCACTTTTACGAATTTACCCAACGCAACGAGC
CGCAAATCCTCGCCACCCTCTCCGACAAGAGCAAAGCCAGCATGCTCGACCGCTACTTTGTCAGCAAGCTCCTCC
AGCTACTATGCGTGCGCGAACTGGCCTCGCGCGCCGGCCCAGCCTACCCCGTGGCCATCAACTGCTTCAACCCGG
GCTTTGTGCAGACGCGGCTGGGCAGGGAGTTTGGCTGGAACTTGTATCTCTGGGGCGTCGTGTTTGCGCGCTCGG
CCCGCGTGGGCAGTCGGACGCTGGTGGCGGCGGCGGGGGCGGGCGCAGAGTCGCATGGCAAGTATATGAGCGAGG
GCGAGGTTGCGGAGCCGAGTGAGTGGGTGAGGAGCGAGGAAGGGAAGAGGGTGCAGAGGAGAGTGTGGGAGGAGG
TGGTGGAGAGGGTGGAGGGGATAGTGCCGGGGGTGAGTGGGAATATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail