Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2573
Gene name
LocationContig_181:33154..34307
Strand-
Gene length (bp)1153
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02811 PHP PHP domain 7.2E-25 5 216

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14059|HIS9_SCHPO Probable histidinol-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.01 PE=3 SV=1 1 295 2.0E-70
sp|P38635|HIS9_YEAST Histidinol-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS2 PE=1 SV=2 6 302 5.0E-43
sp|Q9RX45|HIS9_DEIRA Probable histidinol-phosphatase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisK PE=3 SV=1 6 269 6.0E-11
sp|O34411|HIS9_BACSU Histidinol-phosphatase OS=Bacillus subtilis (strain 168) GN=hisK PE=1 SV=1 12 236 3.0E-09

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2573
MAFTMHSHSGQFCSHAVDQLEDIIRHAMAIGFTTMGLTEHMPRHEERDLYPEELSDAAASLAAMVPRHQAYLAEA
QRLRAKYASSIRILIGFEAEYIRPSYGPMVHELALAPCIDYFIGSVHHVHGFPIDYDAASYSAAISAAGGSEMLL
YQAYYDLQLQMLRDLTPRIIGHFDLIRLLSADSARDVRQWPSVWSRIQRNLALAAEQGAWIECNTSALRKGLAEP
YPCRAIAEEWLRLGGKFTMSDDSHGIAHVATNYARGVSYLESLGVTHVCTFTPAPPASSPTSQEPTLQELAVPLT
EFRKHL*
Coding >OphauB2|2573
ATGGCCTTTACTATGCATTCCCATTCGGGCCAATTCTGCAGCCACGCCGTCGACCAACTCGAAGACATTATCCGC
CACGCCATGGCCATTGGCTTCACCACCATGGGCCTCACCGAGCACATGCCACGTCATGAGGAGCGCGACCTCTAT
CCCGAAGAGTTATCCGATGCCGCAGCCAGCCTTGCCGCCATGGTGCCTCGCCACCAAGCCTATCTCGCCGAGGCT
CAGCGCCTCAGGGCCAAATACGCCTCCTCCATTCGCATTCTCATTGGCTTTGAAGCAGAATACATTCGACCCTCC
TACGGCCCCATGGTTCATGAGCTGGCCCTCGCTCCTTGCATCGACTACTTCATCGGCTCTGTTCACCACGTCCAC
GGCTTCCCCATTGACTATGATGCCGCGTCATACTCGGCCGCCATTTCCGCCGCAGGTGGCTCCGAGATGCTTCTT
TACCAAGCCTACTATGATTTGCAGCTCCAAATGCTGCGCGACCTGACGCCTCGTATCATTGGCCATTTTGATCTC
ATTCGCCTGCTCAGCGCCGATTCCGCTAGAGACGTGCGCCAGTGGCCCTCGGTCTGGTCTCGCATTCAGCGCAAC
CTTGCTCTCGCTGCCGAGCAGGGCGCATGGATAGAGTGCAACACGTCTGCTCTTAGAAAGGGTCTTGCCGAGCCG
TATCCGTGTCGCGCCATTGCCGAGGAGTGGCTCAGGCTCGGCGGCAAATTCACCATGTCTGACGATAGTCACGGC
ATTGCCCATGTTGCTACAAACTATGCCCGTGGCGTCTCATATCTCGAGAGCCTCGGCGTCACTCACGTCTGCACC
TTTACACCGGCGCCGCCCGCTTCATCTCCAACGTCACAAGAGCCCACTTTGCAAGAGTTGGCAGTACCTTTGACC
GAGTTCCGGAAGCATCTCTGA
Transcript >OphauB2|2573
ATGGCCTTTACTATGCATTCCCATTCGGGCCAATTCTGCAGCCACGCCGTCGACCAACTCGAAGACATTATCCGC
CACGCCATGGCCATTGGCTTCACCACCATGGGCCTCACCGAGCACATGCCACGTCATGAGGAGCGCGACCTCTAT
CCCGAAGAGTTATCCGATGCCGCAGCCAGCCTTGCCGCCATGGTGCCTCGCCACCAAGCCTATCTCGCCGAGGCT
CAGCGCCTCAGGGCCAAATACGCCTCCTCCATTCGCATTCTCATTGGCTTTGAAGCAGAATACATTCGACCCTCC
TACGGCCCCATGGTTCATGAGCTGGCCCTCGCTCCTTGCATCGACTACTTCATCGGCTCTGTTCACCACGTCCAC
GGCTTCCCCATTGACTATGATGCCGCGTCATACTCGGCCGCCATTTCCGCCGCAGGTGGCTCCGAGATGCTTCTT
TACCAAGCCTACTATGATTTGCAGCTCCAAATGCTGCGCGACCTGACGCCTCGTATCATTGGCCATTTTGATCTC
ATTCGCCTGCTCAGCGCCGATTCCGCTAGAGACGTGCGCCAGTGGCCCTCGGTCTGGTCTCGCATTCAGCGCAAC
CTTGCTCTCGCTGCCGAGCAGGGCGCATGGATAGAGTGCAACACGTCTGCTCTTAGAAAGGGTCTTGCCGAGCCG
TATCCGTGTCGCGCCATTGCCGAGGAGTGGCTCAGGCTCGGCGGCAAATTCACCATGTCTGACGATAGTCACGGC
ATTGCCCATGTTGCTACAAACTATGCCCGTGGCGTCTCATATCTCGAGAGCCTCGGCGTCACTCACGTCTGCACC
TTTACACCGGCGCCGCCCGCTTCATCTCCAACGTCACAAGAGCCCACTTTGCAAGAGTTGGCAGTACCTTTGACC
GAGTTCCGGAAGCATCTCTGA
Gene >OphauB2|2573
ATGGCCTTTACTATGCATTCCCATTCGGGCCAATTCTGCAGCCACGCCGTCGACCAACTCGAAGACATTATCCGC
CACGCCATGGCCATTGGCTTCACCACCATGGGCCTCACCGAGCACATGCCACGTCATGAGGAGCGCGACCTCTAT
CCCGAAGAGGTGCCTCCTCCCAATATCCCACCTCCCTTTTCTTGAACCCCAATCCCTCCAATCAAAAAGATAACA
CTCCTCGGGCGCCTTTGCTAGTTATCCGATGCCGCAGCCAGCCTTGCCGCCATGGTGCCTCGCCACCAAGCCTAT
CTCGCCGAGGCTCAGCGCCTCAGGGCCAAATACGCCTCCTCCATTCGCATTCTCATTGGCTTTGAAGCAGAATAC
ATTCGACCCTCCTACGGCCCCATGGTTCATGAGCTGGCCCTCGCTCCTTGCATCGACTACTTCATCGGCTCTGTT
CACCACGTCCACGGCTTCCCCATTGACTATGATGCCGCGTCATACTCGGCCGCCATTTCCGCCGCAGGTGGCTCC
GAGATGCTTCTTTACCAAGCCTACTATGATTTGCAGCTCCAAATGCTGCGCGACCTGACGCCTCGTATCATTGGC
CATTTTGATCTCATTCGCCTGCTCAGCGCCGATTCCGCTAGAGACGTGCGCCAGTGGCCCTCGGTCTGGTCTCGC
ATTCAGCGCAACCTTGCTCTCGCTGCCGAGCAGGGCGCATGGATAGAGTGCAACACGTCTGCTCTTAGAAAGGGT
CTTGCCGAGCCGTATCCGTGTCGCGCCATTGCCGAGGTAAGTCTGAGCCAGTCTGTCGTGTCTGACTTTTTTTTC
TTTTCTTTTTTTCTTCCTTTTCTTTCTTTTTTTTTCTGCTCCTTGATACTCGGCCAATTGCTGCTAGTCCATCAC
TTGATCCTCTTGTGTTGATTCAAATTGTCAGGAGTGGCTCAGGCTCGGCGGCAAATTCACCATGTCTGACGATAG
TCACGGCATTGCCCATGTTGCTACAAACTATGCCCGTGGCGTCTCATATCTCGAGAGCCTCGGCGTCACTCACGT
CTGCACCTTTACACCGGCGCCGCCCGCTTCATCTCCAACGTCACAAGAGCCCACTTTGCAAGAGTTGGCAGTACC
TTTGACCGAGTTCCGGAAGCATCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail