Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2567
Gene name
LocationContig_181:18591..22210
Strand-
Gene length (bp)3619
Transcript length (bp)3513
Coding sequence length (bp)3513
Protein length (aa) 1171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 2.3E-08 10 57
PF07653 SH3_2 Variant SH3 domain 1.8E-06 11 63

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42854|YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.17 PE=1 SV=1 913 1169 3.0E-55
sp|P47068|BBC1_YEAST Myosin tail region-interacting protein MTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BBC1 PE=1 SV=2 3 312 3.0E-13
sp|O42854|YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.17 PE=1 SV=1 4 65 4.0E-10
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 6 78 3.0E-07
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 6 78 4.0E-07

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2567
MAAPLRVKSLYEYSSPHEDDLNFAVGQVITVTDDDDPEWYGGEYIDQDGVKQEGIFPRNFVEKFEPTAPPRPARS
RPKKESEAAHEATAAPAPPLPAKDDDTQAQQPDAETTLAPAEAASADAPIPLPSQPDEPAPTMTSAPAAPKTSEP
RTIGAPPASPATKMKPSAPPPVSEKPASSSFKDRIAAFNKAAAPPIAPFKPGGLGGGSGSSTFIKKPFVAPPPSR
NAYVAPPRDPPTPTVYKRQEDPEIREREAQNMQNAEKAGLVPADQAHGGADQDQPKPTSLKERIALLQKQQMEQA
SRHAEAAAKKEKPKKPPKKRSESTPSVEAVQEAIEGGPPVVPERAVAEDTGTPTEARPTVKAPPAPRRKSSKGPT
HESVHDGNEADMSGAGDTTEDQDDTTEREDSDGTPRHVSRADTTSTMASGAKEETDDDATAEAEGEDEIDPEIRR
KEELRARMAKMSGGMGFHGMFGGPMAPVVPATPKKKEAKAEGSGSTADGGEAAGSSTYIAPPIATPMALPGFGGP
RQADEEEAGGSSRAPPPALPVRSATEDRMNRADESEQDDEEDEAATPAPVAEPQSPSALLAGSGSRAAPRAVPAE
GRPVLGIATMDAKSANDGFESDDEMSGGAREADVPNVSAAAARSPPMLPQAVQSPGASGRSPPLSPQGEDTSPTS
PSAPTHHRNSRLPPPVPGSAPALPPAHTRPPPPPPPGGLLRRQSTADSPVAPSAPVRPLQAGQDNDGEVTEYEGD
YDTDIASSVPHKDALKSSQEQGTVQSPVAEAPRAQPPPLPSASAPRAVPPPVPVGSSSDSSKRRSIDAPRAAPPP
PPPTIKEGTGHDEAGMDSYNYANASHAAATSGFSHRTPKIEEEAPRSPAVSPVERRAPPGNGRGRPSMDVPRTSM
SNRRSVDLHRPSMESGFIANDIDLAVQSGWWKQANQVPPVLQGRRDICFECAESTSTNQGAKTVTTREIAVLYQD
YSQTILTVRFDPYDPSDVELEQRHESPPRALRQDQMEQYYDSLGRRISEAAAARKDSVVGDGTPQSLVLELLRPL
KEALGPVGTRAYGALVYSNLANASTQQHDVIRAGDIMTVRNAKFQGKHGAMHAKYSVEVGKPDHVAVVAEWDGTK
KKVRAWEQGRESKKVKLESFKLDDLRSGEVKIWRVVPRSWVGWEM*
Coding >OphauB2|2567
ATGGCGGCGCCGCTCCGGGTCAAGTCTCTATACGAGTATTCGTCGCCGCATGAAGACGACCTCAACTTTGCCGTC
GGCCAAGTCATTACTGTCACTGACGACGACGACCCAGAATGGTACGGTGGCGAATATATTGACCAGGATGGCGTA
AAGCAGGAAGGGATTTTTCCTCGCAATTTTGTCGAGAAGTTTGAGCCAACTGCGCCGCCTCGGCCGGCAAGAAGT
CGCCCCAAGAAGGAATCCGAGGCCGCTCATGAAGCAACTGCGGCGCCAGCTCCGCCGCTGCCGGCCAAGGATGAT
GACACACAAGCGCAGCAGCCGGATGCCGAGACAACACTGGCACCAGCTGAAGCTGCGTCTGCCGATGCCCCCATT
CCTCTTCCATCTCAGCCTGACGAGCCTGCTCCGACCATGACGTCGGCACCGGCAGCGCCCAAGACAAGCGAGCCG
CGAACAATAGGTGCTCCGCCTGCTTCTCCTGCCACCAAGATGAAGCCTTCAGCTCCGCCTCCCGTTTCCGAGAAG
CCTGCCAGTAGTTCGTTCAAGGACCGCATCGCCGCATTTAATAAAGCTGCTGCGCCGCCGATAGCTCCCTTCAAA
CCCGGCGGCCTCGGCGGTGGTAGCGGTAGCTCCACCTTTATCAAGAAGCCGTTTGTTGCTCCTCCGCCAAGTCGA
AATGCCTATGTTGCTCCTCCTCGTGACCCGCCTACGCCGACGGTCTATAAGCGCCAAGAGGATCCTGAGATTAGG
GAGCGTGAAGCTCAAAATATGCAGAATGCTGAAAAGGCTGGCCTCGTTCCAGCCGACCAGGCTCATGGCGGTGCA
GACCAAGATCAACCAAAGCCTACCAGCCTCAAGGAACGGATTGCTCTCCTCCAAAAGCAGCAGATGGAGCAAGCG
TCACGCCACGCCGAGGCTGCGGCAAAGAAGGAGAAGCCAAAGAAGCCTCCCAAGAAGCGAAGCGAATCTACCCCT
TCGGTTGAAGCTGTCCAGGAAGCGATTGAGGGCGGCCCTCCTGTCGTTCCGGAGCGTGCGGTGGCTGAAGACACC
GGCACACCTACAGAAGCACGACCTACAGTAAAGGCTCCACCTGCTCCTCGTCGTAAATCATCCAAAGGGCCCACG
CATGAAAGTGTCCATGACGGTAACGAAGCCGACATGTCGGGCGCTGGCGACACGACTGAGGACCAGGACGACACG
ACTGAGCGTGAGGACAGCGACGGGACACCACGACATGTTTCTCGGGCTGACACAACATCTACAATGGCCTCGGGT
GCCAAAGAAGAAACTGATGACGACGCAACTGCTGAGGCAGAGGGCGAGGACGAAATTGACCCGGAAATCAGGCGC
AAAGAAGAGCTGCGAGCACGAATGGCAAAGATGAGCGGAGGGATGGGCTTTCACGGCATGTTTGGCGGACCCATG
GCTCCCGTGGTACCTGCAACGCCCAAAAAGAAGGAAGCAAAAGCAGAAGGCTCGGGCTCTACTGCCGATGGGGGC
GAAGCAGCAGGATCGAGCACATACATTGCCCCTCCGATTGCAACGCCCATGGCTCTCCCGGGCTTTGGAGGGCCG
AGGCAGGCTGACGAGGAAGAAGCTGGAGGCTCGTCAAGAGCGCCTCCTCCGGCATTGCCAGTGCGGTCAGCCACT
GAGGACAGGATGAATCGGGCAGACGAGAGCGAGCAAGATGACGAGGAAGACGAGGCCGCAACGCCGGCCCCGGTA
GCGGAGCCCCAATCACCCAGCGCACTCCTGGCAGGGTCTGGCAGTCGTGCAGCGCCTCGTGCCGTGCCAGCAGAG
GGTCGGCCAGTGCTTGGGATAGCGACCATGGACGCCAAATCTGCTAATGACGGATTCGAGTCGGACGACGAAATG
TCGGGGGGGGCACGTGAGGCAGATGTGCCCAATGTGAGCGCGGCGGCTGCACGATCCCCCCCAATGCTACCCCAG
GCGGTGCAATCGCCAGGAGCCTCTGGGCGCTCGCCACCACTGTCGCCTCAAGGAGAGGACACATCGCCAACGTCA
CCCAGTGCGCCGACACATCACCGCAACAGCAGGCTTCCGCCTCCAGTGCCGGGATCTGCGCCTGCGCTTCCTCCT
GCTCACACACGCCCCCCACCGCCGCCACCCCCTGGCGGCCTGCTCAGGCGCCAGTCGACGGCAGATAGTCCTGTG
GCCCCAAGCGCGCCAGTGCGGCCTCTGCAGGCTGGGCAAGACAATGACGGGGAGGTGACTGAGTATGAAGGCGAC
TACGATACGGACATTGCGTCGTCGGTCCCACACAAGGATGCCCTCAAGTCGAGCCAGGAGCAAGGCACGGTGCAG
TCGCCGGTAGCGGAAGCCCCAAGGGCACAGCCACCGCCACTGCCGTCAGCCTCGGCCCCTCGGGCGGTGCCGCCA
CCTGTGCCTGTAGGCTCGTCCTCGGACAGCAGCAAACGGCGCTCCATTGACGCACCCCGGGCCGCGCCGCCGCCA
CCGCCACCTACAATCAAGGAAGGGACTGGGCATGATGAGGCTGGCATGGACTCGTACAACTACGCAAATGCCTCT
CATGCAGCAGCCACGTCTGGCTTTAGTCATCGCACGCCCAAGATTGAAGAGGAGGCACCGCGCTCGCCTGCCGTG
TCACCTGTGGAGCGGAGAGCGCCGCCAGGCAATGGGCGTGGCAGGCCATCCATGGACGTGCCGAGGACCAGCATG
AGCAACCGTCGATCCGTCGACTTGCATCGTCCATCCATGGAATCGGGCTTCATCGCCAATGACATTGACTTGGCG
GTGCAGAGTGGGTGGTGGAAGCAGGCCAACCAGGTGCCTCCGGTGCTCCAGGGGCGGCGGGACATTTGTTTTGAG
TGCGCCGAGTCGACGTCAACCAACCAAGGGGCCAAGACGGTGACGACGCGCGAGATTGCGGTGCTCTACCAGGAC
TACTCGCAGACGATTTTGACGGTGCGGTTTGACCCGTACGACCCGTCAGACGTGGAGCTGGAGCAGCGCCACGAG
TCTCCTCCGCGGGCGCTGCGCCAAGACCAAATGGAACAGTACTACGACAGCCTGGGGCGGCGCATCTCGGAAGCA
GCCGCGGCTAGAAAGGACTCGGTGGTGGGAGACGGCACGCCGCAGAGCCTGGTGCTGGAGCTGCTGCGTCCGTTG
AAGGAGGCTCTGGGCCCCGTGGGAACGCGGGCGTACGGGGCGCTTGTGTACTCCAACCTGGCCAACGCATCGACG
CAGCAGCACGACGTGATTCGCGCGGGCGACATCATGACGGTCCGCAATGCCAAGTTTCAGGGCAAGCACGGCGCA
ATGCATGCCAAATACTCTGTCGAGGTGGGAAAGCCGGACCATGTTGCCGTGGTGGCGGAATGGGACGGCACCAAG
AAGAAGGTGAGAGCGTGGGAGCAAGGGCGTGAGAGCAAAAAGGTCAAGCTGGAGAGCTTCAAGCTCGACGACTTG
CGCAGCGGAGAGGTCAAGATTTGGCGCGTGGTGCCGCGCAGCTGGGTGGGCTGGGAGATGTGA
Transcript >OphauB2|2567
ATGGCGGCGCCGCTCCGGGTCAAGTCTCTATACGAGTATTCGTCGCCGCATGAAGACGACCTCAACTTTGCCGTC
GGCCAAGTCATTACTGTCACTGACGACGACGACCCAGAATGGTACGGTGGCGAATATATTGACCAGGATGGCGTA
AAGCAGGAAGGGATTTTTCCTCGCAATTTTGTCGAGAAGTTTGAGCCAACTGCGCCGCCTCGGCCGGCAAGAAGT
CGCCCCAAGAAGGAATCCGAGGCCGCTCATGAAGCAACTGCGGCGCCAGCTCCGCCGCTGCCGGCCAAGGATGAT
GACACACAAGCGCAGCAGCCGGATGCCGAGACAACACTGGCACCAGCTGAAGCTGCGTCTGCCGATGCCCCCATT
CCTCTTCCATCTCAGCCTGACGAGCCTGCTCCGACCATGACGTCGGCACCGGCAGCGCCCAAGACAAGCGAGCCG
CGAACAATAGGTGCTCCGCCTGCTTCTCCTGCCACCAAGATGAAGCCTTCAGCTCCGCCTCCCGTTTCCGAGAAG
CCTGCCAGTAGTTCGTTCAAGGACCGCATCGCCGCATTTAATAAAGCTGCTGCGCCGCCGATAGCTCCCTTCAAA
CCCGGCGGCCTCGGCGGTGGTAGCGGTAGCTCCACCTTTATCAAGAAGCCGTTTGTTGCTCCTCCGCCAAGTCGA
AATGCCTATGTTGCTCCTCCTCGTGACCCGCCTACGCCGACGGTCTATAAGCGCCAAGAGGATCCTGAGATTAGG
GAGCGTGAAGCTCAAAATATGCAGAATGCTGAAAAGGCTGGCCTCGTTCCAGCCGACCAGGCTCATGGCGGTGCA
GACCAAGATCAACCAAAGCCTACCAGCCTCAAGGAACGGATTGCTCTCCTCCAAAAGCAGCAGATGGAGCAAGCG
TCACGCCACGCCGAGGCTGCGGCAAAGAAGGAGAAGCCAAAGAAGCCTCCCAAGAAGCGAAGCGAATCTACCCCT
TCGGTTGAAGCTGTCCAGGAAGCGATTGAGGGCGGCCCTCCTGTCGTTCCGGAGCGTGCGGTGGCTGAAGACACC
GGCACACCTACAGAAGCACGACCTACAGTAAAGGCTCCACCTGCTCCTCGTCGTAAATCATCCAAAGGGCCCACG
CATGAAAGTGTCCATGACGGTAACGAAGCCGACATGTCGGGCGCTGGCGACACGACTGAGGACCAGGACGACACG
ACTGAGCGTGAGGACAGCGACGGGACACCACGACATGTTTCTCGGGCTGACACAACATCTACAATGGCCTCGGGT
GCCAAAGAAGAAACTGATGACGACGCAACTGCTGAGGCAGAGGGCGAGGACGAAATTGACCCGGAAATCAGGCGC
AAAGAAGAGCTGCGAGCACGAATGGCAAAGATGAGCGGAGGGATGGGCTTTCACGGCATGTTTGGCGGACCCATG
GCTCCCGTGGTACCTGCAACGCCCAAAAAGAAGGAAGCAAAAGCAGAAGGCTCGGGCTCTACTGCCGATGGGGGC
GAAGCAGCAGGATCGAGCACATACATTGCCCCTCCGATTGCAACGCCCATGGCTCTCCCGGGCTTTGGAGGGCCG
AGGCAGGCTGACGAGGAAGAAGCTGGAGGCTCGTCAAGAGCGCCTCCTCCGGCATTGCCAGTGCGGTCAGCCACT
GAGGACAGGATGAATCGGGCAGACGAGAGCGAGCAAGATGACGAGGAAGACGAGGCCGCAACGCCGGCCCCGGTA
GCGGAGCCCCAATCACCCAGCGCACTCCTGGCAGGGTCTGGCAGTCGTGCAGCGCCTCGTGCCGTGCCAGCAGAG
GGTCGGCCAGTGCTTGGGATAGCGACCATGGACGCCAAATCTGCTAATGACGGATTCGAGTCGGACGACGAAATG
TCGGGGGGGGCACGTGAGGCAGATGTGCCCAATGTGAGCGCGGCGGCTGCACGATCCCCCCCAATGCTACCCCAG
GCGGTGCAATCGCCAGGAGCCTCTGGGCGCTCGCCACCACTGTCGCCTCAAGGAGAGGACACATCGCCAACGTCA
CCCAGTGCGCCGACACATCACCGCAACAGCAGGCTTCCGCCTCCAGTGCCGGGATCTGCGCCTGCGCTTCCTCCT
GCTCACACACGCCCCCCACCGCCGCCACCCCCTGGCGGCCTGCTCAGGCGCCAGTCGACGGCAGATAGTCCTGTG
GCCCCAAGCGCGCCAGTGCGGCCTCTGCAGGCTGGGCAAGACAATGACGGGGAGGTGACTGAGTATGAAGGCGAC
TACGATACGGACATTGCGTCGTCGGTCCCACACAAGGATGCCCTCAAGTCGAGCCAGGAGCAAGGCACGGTGCAG
TCGCCGGTAGCGGAAGCCCCAAGGGCACAGCCACCGCCACTGCCGTCAGCCTCGGCCCCTCGGGCGGTGCCGCCA
CCTGTGCCTGTAGGCTCGTCCTCGGACAGCAGCAAACGGCGCTCCATTGACGCACCCCGGGCCGCGCCGCCGCCA
CCGCCACCTACAATCAAGGAAGGGACTGGGCATGATGAGGCTGGCATGGACTCGTACAACTACGCAAATGCCTCT
CATGCAGCAGCCACGTCTGGCTTTAGTCATCGCACGCCCAAGATTGAAGAGGAGGCACCGCGCTCGCCTGCCGTG
TCACCTGTGGAGCGGAGAGCGCCGCCAGGCAATGGGCGTGGCAGGCCATCCATGGACGTGCCGAGGACCAGCATG
AGCAACCGTCGATCCGTCGACTTGCATCGTCCATCCATGGAATCGGGCTTCATCGCCAATGACATTGACTTGGCG
GTGCAGAGTGGGTGGTGGAAGCAGGCCAACCAGGTGCCTCCGGTGCTCCAGGGGCGGCGGGACATTTGTTTTGAG
TGCGCCGAGTCGACGTCAACCAACCAAGGGGCCAAGACGGTGACGACGCGCGAGATTGCGGTGCTCTACCAGGAC
TACTCGCAGACGATTTTGACGGTGCGGTTTGACCCGTACGACCCGTCAGACGTGGAGCTGGAGCAGCGCCACGAG
TCTCCTCCGCGGGCGCTGCGCCAAGACCAAATGGAACAGTACTACGACAGCCTGGGGCGGCGCATCTCGGAAGCA
GCCGCGGCTAGAAAGGACTCGGTGGTGGGAGACGGCACGCCGCAGAGCCTGGTGCTGGAGCTGCTGCGTCCGTTG
AAGGAGGCTCTGGGCCCCGTGGGAACGCGGGCGTACGGGGCGCTTGTGTACTCCAACCTGGCCAACGCATCGACG
CAGCAGCACGACGTGATTCGCGCGGGCGACATCATGACGGTCCGCAATGCCAAGTTTCAGGGCAAGCACGGCGCA
ATGCATGCCAAATACTCTGTCGAGGTGGGAAAGCCGGACCATGTTGCCGTGGTGGCGGAATGGGACGGCACCAAG
AAGAAGGTGAGAGCGTGGGAGCAAGGGCGTGAGAGCAAAAAGGTCAAGCTGGAGAGCTTCAAGCTCGACGACTTG
CGCAGCGGAGAGGTCAAGATTTGGCGCGTGGTGCCGCGCAGCTGGGTGGGCTGGGAGATGTGA
Gene >OphauB2|2567
ATGGCGGCGCCGCTCCGGGTCAAGTCTCTATACGAGTATTCGTCGCCGCATGAAGACGACCTCAACTTTGCCGTC
GGCCAAGTCATTACTGTCACTGACGACGACGACCCAGAATGGTACGGTGGCGAATATATTGACCAGGATGGCGTA
AAGCAGGAAGGGATTTTTCCTCGCAATTTTGTCGAGAAGTTTGAGCCAACTGCGCCGCCTCGGCCGGCAAGAAGT
CGCCCCAAGAAGGAATCCGAGGCCGCTCATGAAGCAACTGCGGCGCCAGCTCCGCCGCTGCCGGCCAAGGATGAT
GACACACAAGCGCAGCAGCCGGATGCCGAGACAACACTGGCACCAGCTGAAGCTGCGTCTGCCGATGCCCCCATT
CCTCTTCCATCTCAGCCTGACGAGCCTGCTCCGACCATGACGTCGGCACCGGCAGCGCCCAAGACAAGCGAGCCG
CGAACAATAGGTGCTCCGCCTGCTTCTCCTGCCACCAAGATGAAGCCTTCAGCTCCGCCTCCCGTTTCCGAGAAG
CCTGCCAGTAGTTCGTTCAAGGACCGCATCGCCGCATTTAATAAAGCTGCTGCGCCGCCGATAGCTCCCTTCAAA
CCCGGCGGCCTCGGCGGTGGTAGCGGTAGCTCCACCTTTATCAAGAAGCCGTTTGTTGCTCCTCCGCCAAGTCGA
AATGCCTATGTTGCTCCTCCTCGTGACCCGCCTACGCCGACGGTCTATAAGCGCCAAGAGGATCCTGAGATTAGG
GAGCGTGAAGCTCAAAATATGCAGAATGCTGAAAAGGCTGGCCTCGTTCCAGCCGACCAGGCTCATGGCGGTGCA
GACCAAGATCAACCAAAGCCTACCAGCCTCAAGGAACGGATTGCTCTCCTCCAAAAGCAGCAGATGGAGCAAGCG
TCACGCCACGCCGAGGCTGCGGCAAAGAAGGAGAAGCCAAAGAAGCCTCCCAAGAAGCGAAGCGAATCTACCCCT
TCGGTTGAAGCTGTCCAGGAAGCGATTGAGGGCGGCCCTCCTGTCGTTCCGGAGCGTGCGGTGGCTGAAGACACC
GGCACACCTACAGAAGCACGACCTACAGTAAAGGCTCCACCTGCTCCTCGTCGTAAATCATCCAAAGGGCCCACG
CATGAAAGTGTCCATGACGGTAACGAAGCCGACATGTCGGGCGCTGGCGACACGACTGAGGACCAGGACGACACG
ACTGAGCGTGAGGACAGCGACGGGACACCACGACATGTTTCTCGGGCTGACACAACATCTACAATGGCCTCGGGT
GCCAAAGAAGAAACTGATGACGACGCAACTGCTGAGGCAGAGGGCGAGGACGAAATTGACCCGGAAATCAGGCGC
AAAGAAGAGCTGCGAGCACGAATGGCAAAGATGAGCGGAGGGATGGGCTTTCACGGCATGTTTGGCGGACCCATG
GCTCCCGTGGTACCTGCAACGCCCAAAAAGAAGGAAGCAAAAGCAGAAGGCTCGGGCTCTACTGCCGATGGGGGC
GAAGCAGCAGGATCGAGCACATACATTGCCCCTCCGATTGCAACGCCCATGGCTCTCCCGGGCTTTGGAGGGCCG
AGGCAGGCTGACGAGGAAGAAGCTGGAGGCTCGTCAAGAGCGCCTCCTCCGGCATTGCCAGTGCGGTCAGCCACT
GAGGACAGGATGAATCGGGCAGACGAGAGCGAGCAAGATGACGAGGAAGACGAGGCCGCAACGCCGGCCCCGGTA
GCGGAGCCCCAATGTAAAAAGACTTGTGCTACACCCACTATGCTCGAGGCAGTCTGCTAACTGAGGCGTAGCACC
CAGCGCACTCCTGGCAGGGTCTGGCAGTCGTGCAGCGCCTCGTGCCGTGCCAGCAGAGGGTAAGATTGACCCAAG
ACATGGCGGCGTGCAACTGACAAGAGGAGCAGGTCGGCCAGTGCTTGGGATAGCGACCATGGACGCCAAATCTGC
TAATGACGGATTCGAGTCGGACGACGAAATGTCGGGGGGGGCACGTGAGGCAGATGTGCCCAATGTGAGCGCGGC
GGCTGCACGATCCCCCCCAATGCTACCCCAGGCGGTGCAATCGCCAGGAGCCTCTGGGCGCTCGCCACCACTGTC
GCCTCAAGGAGAGGACACATCGCCAACGTCACCCAGTGCGCCGACACATCACCGCAACAGCAGGCTTCCGCCTCC
AGTGCCGGGATCTGCGCCTGCGCTTCCTCCTGCTCACACACGCCCCCCACCGCCGCCACCCCCTGGCGGCCTGCT
CAGGCGCCAGTCGACGGCAGATAGTCCTGTGGCCCCAAGCGCGCCAGTGCGGCCTCTGCAGGCTGGGCAAGACAA
TGACGGGGAGGTGACTGAGTATGAAGGCGACTACGATACGGACATTGCGTCGTCGGTCCCACACAAGGATGCCCT
CAAGTCGAGCCAGGAGCAAGGCACGGTGCAGTCGCCGGTAGCGGAAGCCCCAAGGGCACAGCCACCGCCACTGCC
GTCAGCCTCGGCCCCTCGGGCGGTGCCGCCACCTGTGCCTGTAGGCTCGTCCTCGGACAGCAGCAAACGGCGCTC
CATTGACGCACCCCGGGCCGCGCCGCCGCCACCGCCACCTACAATCAAGGAAGGGACTGGGCATGATGAGGCTGG
CATGGACTCGTACAACTACGCAAATGCCTCTCATGCAGCAGCCACGTCTGGCTTTAGTCATCGCACGCCCAAGAT
TGAAGAGGAGGCACCGCGCTCGCCTGCCGTGTCACCTGTGGAGCGGAGAGCGCCGCCAGGCAATGGGCGTGGCAG
GCCATCCATGGACGTGCCGAGGACCAGCATGAGCAACCGTCGATCCGTCGACTTGCATCGTCCATCCATGGAATC
GGGCTTCATCGCCAATGACATTGACTTGGCGGTGCAGAGTGGGTGGTGGAAGCAGGCCAACCAGGTGCCTCCGGT
GCTCCAGGGGCGGCGGGACATTTGTTTTGAGTGCGCCGAGTCGACGTCAACCAACCAAGGGGCCAAGACGGTGAC
GACGCGCGAGATTGCGGTGCTCTACCAGGACTACTCGCAGACGATTTTGACGGTGCGGTTTGACCCGTACGACCC
GTCAGACGTGGAGCTGGAGCAGCGCCACGAGTCTCCTCCGCGGGCGCTGCGCCAAGACCAAATGGAACAGTACTA
CGACAGCCTGGGGCGGCGCATCTCGGAAGCAGCCGCGGCTAGAAAGGACTCGGTGGTGGGAGACGGCACGCCGCA
GAGCCTGGTGCTGGAGCTGCTGCGTCCGTTGAAGGAGGCTCTGGGCCCCGTGGGAACGCGGGCGTACGGGGCGCT
TGTGTACTCCAACCTGGCCAACGCATCGACGCAGCAGCACGACGTGATTCGCGCGGGCGACATCATGACGGTCCG
CAATGCCAAGTTTCAGGGCAAGCACGGCGCAATGCATGCCAAATACTCTGTCGAGGTGGGAAAGCCGGACCATGT
TGCCGTGGTGGCGGAATGGGACGGCACCAAGAAGAAGGTGAGAGCGTGGGAGCAAGGGCGTGAGAGCAAAAAGGT
CAAGCTGGAGAGCTTCAAGCTCGACGACTTGCGCAGCGGAGAGGTCAAGATTTGGCGCGTGGTGCCGCGCAGCTG
GGTGGGCTGGGAGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail