Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2567
Gene name
LocationContig_181:18591..22210
Strand-
Gene length (bp)3619
Transcript length (bp)3513
Coding sequence length (bp)3513
Protein length (aa) 1171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 2.3E-08 10 57
PF07653 SH3_2 Variant SH3 domain 1.8E-06 11 63

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42854|YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.17 PE=1 SV=1 913 1169 3.0E-55
sp|P47068|BBC1_YEAST Myosin tail region-interacting protein MTI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BBC1 PE=1 SV=2 3 312 3.0E-13
sp|O42854|YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.17 PE=1 SV=1 4 65 4.0E-10
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 6 78 3.0E-07
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 6 78 4.0E-07

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup898
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|451
Ophiocordyceps australis map64 (Brazil) OphauB2|2567 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06370
Ophiocordyceps camponoti-rufipedis Ophun1|3738
Ophiocordyceps kimflemingae Ophio5|4600
Ophiocordyceps subramaniannii Hirsu2|5831
Ophiocordyceps subramaniannii Hirsu2|9299

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2567
MAAPLRVKSLYEYSSPHEDDLNFAVGQVITVTDDDDPEWYGGEYIDQDGVKQEGIFPRNFVEKFEPTAPPRPARS
RPKKESEAAHEATAAPAPPLPAKDDDTQAQQPDAETTLAPAEAASADAPIPLPSQPDEPAPTMTSAPAAPKTSEP
RTIGAPPASPATKMKPSAPPPVSEKPASSSFKDRIAAFNKAAAPPIAPFKPGGLGGGSGSSTFIKKPFVAPPPSR
NAYVAPPRDPPTPTVYKRQEDPEIREREAQNMQNAEKAGLVPADQAHGGADQDQPKPTSLKERIALLQKQQMEQA
SRHAEAAAKKEKPKKPPKKRSESTPSVEAVQEAIEGGPPVVPERAVAEDTGTPTEARPTVKAPPAPRRKSSKGPT
HESVHDGNEADMSGAGDTTEDQDDTTEREDSDGTPRHVSRADTTSTMASGAKEETDDDATAEAEGEDEIDPEIRR
KEELRARMAKMSGGMGFHGMFGGPMAPVVPATPKKKEAKAEGSGSTADGGEAAGSSTYIAPPIATPMALPGFGGP
RQADEEEAGGSSRAPPPALPVRSATEDRMNRADESEQDDEEDEAATPAPVAEPQSPSALLAGSGSRAAPRAVPAE
GRPVLGIATMDAKSANDGFESDDEMSGGAREADVPNVSAAAARSPPMLPQAVQSPGASGRSPPLSPQGEDTSPTS
PSAPTHHRNSRLPPPVPGSAPALPPAHTRPPPPPPPGGLLRRQSTADSPVAPSAPVRPLQAGQDNDGEVTEYEGD
YDTDIASSVPHKDALKSSQEQGTVQSPVAEAPRAQPPPLPSASAPRAVPPPVPVGSSSDSSKRRSIDAPRAAPPP
PPPTIKEGTGHDEAGMDSYNYANASHAAATSGFSHRTPKIEEEAPRSPAVSPVERRAPPGNGRGRPSMDVPRTSM
SNRRSVDLHRPSMESGFIANDIDLAVQSGWWKQANQVPPVLQGRRDICFECAESTSTNQGAKTVTTREIAVLYQD
YSQTILTVRFDPYDPSDVELEQRHESPPRALRQDQMEQYYDSLGRRISEAAAARKDSVVGDGTPQSLVLELLRPL
KEALGPVGTRAYGALVYSNLANASTQQHDVIRAGDIMTVRNAKFQGKHGAMHAKYSVEVGKPDHVAVVAEWDGTK
KKVRAWEQGRESKKVKLESFKLDDLRSGEVKIWRVVPRSWVGWEM*
Coding >OphauB2|2567
ATGGCGGCGCCGCTCCGGGTCAAGTCTCTATACGAGTATTCGTCGCCGCATGAAGACGACCTCAACTTTGCCGTC
GGCCAAGTCATTACTGTCACTGACGACGACGACCCAGAATGGTACGGTGGCGAATATATTGACCAGGATGGCGTA
AAGCAGGAAGGGATTTTTCCTCGCAATTTTGTCGAGAAGTTTGAGCCAACTGCGCCGCCTCGGCCGGCAAGAAGT
CGCCCCAAGAAGGAATCCGAGGCCGCTCATGAAGCAACTGCGGCGCCAGCTCCGCCGCTGCCGGCCAAGGATGAT
GACACACAAGCGCAGCAGCCGGATGCCGAGACAACACTGGCACCAGCTGAAGCTGCGTCTGCCGATGCCCCCATT
CCTCTTCCATCTCAGCCTGACGAGCCTGCTCCGACCATGACGTCGGCACCGGCAGCGCCCAAGACAAGCGAGCCG
CGAACAATAGGTGCTCCGCCTGCTTCTCCTGCCACCAAGATGAAGCCTTCAGCTCCGCCTCCCGTTTCCGAGAAG
CCTGCCAGTAGTTCGTTCAAGGACCGCATCGCCGCATTTAATAAAGCTGCTGCGCCGCCGATAGCTCCCTTCAAA
CCCGGCGGCCTCGGCGGTGGTAGCGGTAGCTCCACCTTTATCAAGAAGCCGTTTGTTGCTCCTCCGCCAAGTCGA
AATGCCTATGTTGCTCCTCCTCGTGACCCGCCTACGCCGACGGTCTATAAGCGCCAAGAGGATCCTGAGATTAGG
GAGCGTGAAGCTCAAAATATGCAGAATGCTGAAAAGGCTGGCCTCGTTCCAGCCGACCAGGCTCATGGCGGTGCA
GACCAAGATCAACCAAAGCCTACCAGCCTCAAGGAACGGATTGCTCTCCTCCAAAAGCAGCAGATGGAGCAAGCG
TCACGCCACGCCGAGGCTGCGGCAAAGAAGGAGAAGCCAAAGAAGCCTCCCAAGAAGCGAAGCGAATCTACCCCT
TCGGTTGAAGCTGTCCAGGAAGCGATTGAGGGCGGCCCTCCTGTCGTTCCGGAGCGTGCGGTGGCTGAAGACACC
GGCACACCTACAGAAGCACGACCTACAGTAAAGGCTCCACCTGCTCCTCGTCGTAAATCATCCAAAGGGCCCACG
CATGAAAGTGTCCATGACGGTAACGAAGCCGACATGTCGGGCGCTGGCGACACGACTGAGGACCAGGACGACACG
ACTGAGCGTGAGGACAGCGACGGGACACCACGACATGTTTCTCGGGCTGACACAACATCTACAATGGCCTCGGGT
GCCAAAGAAGAAACTGATGACGACGCAACTGCTGAGGCAGAGGGCGAGGACGAAATTGACCCGGAAATCAGGCGC
AAAGAAGAGCTGCGAGCACGAATGGCAAAGATGAGCGGAGGGATGGGCTTTCACGGCATGTTTGGCGGACCCATG
GCTCCCGTGGTACCTGCAACGCCCAAAAAGAAGGAAGCAAAAGCAGAAGGCTCGGGCTCTACTGCCGATGGGGGC
GAAGCAGCAGGATCGAGCACATACATTGCCCCTCCGATTGCAACGCCCATGGCTCTCCCGGGCTTTGGAGGGCCG
AGGCAGGCTGACGAGGAAGAAGCTGGAGGCTCGTCAAGAGCGCCTCCTCCGGCATTGCCAGTGCGGTCAGCCACT
GAGGACAGGATGAATCGGGCAGACGAGAGCGAGCAAGATGACGAGGAAGACGAGGCCGCAACGCCGGCCCCGGTA
GCGGAGCCCCAATCACCCAGCGCACTCCTGGCAGGGTCTGGCAGTCGTGCAGCGCCTCGTGCCGTGCCAGCAGAG
GGTCGGCCAGTGCTTGGGATAGCGACCATGGACGCCAAATCTGCTAATGACGGATTCGAGTCGGACGACGAAATG
TCGGGGGGGGCACGTGAGGCAGATGTGCCCAATGTGAGCGCGGCGGCTGCACGATCCCCCCCAATGCTACCCCAG
GCGGTGCAATCGCCAGGAGCCTCTGGGCGCTCGCCACCACTGTCGCCTCAAGGAGAGGACACATCGCCAACGTCA
CCCAGTGCGCCGACACATCACCGCAACAGCAGGCTTCCGCCTCCAGTGCCGGGATCTGCGCCTGCGCTTCCTCCT
GCTCACACACGCCCCCCACCGCCGCCACCCCCTGGCGGCCTGCTCAGGCGCCAGTCGACGGCAGATAGTCCTGTG
GCCCCAAGCGCGCCAGTGCGGCCTCTGCAGGCTGGGCAAGACAATGACGGGGAGGTGACTGAGTATGAAGGCGAC
TACGATACGGACATTGCGTCGTCGGTCCCACACAAGGATGCCCTCAAGTCGAGCCAGGAGCAAGGCACGGTGCAG
TCGCCGGTAGCGGAAGCCCCAAGGGCACAGCCACCGCCACTGCCGTCAGCCTCGGCCCCTCGGGCGGTGCCGCCA
CCTGTGCCTGTAGGCTCGTCCTCGGACAGCAGCAAACGGCGCTCCATTGACGCACCCCGGGCCGCGCCGCCGCCA
CCGCCACCTACAATCAAGGAAGGGACTGGGCATGATGAGGCTGGCATGGACTCGTACAACTACGCAAATGCCTCT
CATGCAGCAGCCACGTCTGGCTTTAGTCATCGCACGCCCAAGATTGAAGAGGAGGCACCGCGCTCGCCTGCCGTG
TCACCTGTGGAGCGGAGAGCGCCGCCAGGCAATGGGCGTGGCAGGCCATCCATGGACGTGCCGAGGACCAGCATG
AGCAACCGTCGATCCGTCGACTTGCATCGTCCATCCATGGAATCGGGCTTCATCGCCAATGACATTGACTTGGCG
GTGCAGAGTGGGTGGTGGAAGCAGGCCAACCAGGTGCCTCCGGTGCTCCAGGGGCGGCGGGACATTTGTTTTGAG
TGCGCCGAGTCGACGTCAACCAACCAAGGGGCCAAGACGGTGACGACGCGCGAGATTGCGGTGCTCTACCAGGAC
TACTCGCAGACGATTTTGACGGTGCGGTTTGACCCGTACGACCCGTCAGACGTGGAGCTGGAGCAGCGCCACGAG
TCTCCTCCGCGGGCGCTGCGCCAAGACCAAATGGAACAGTACTACGACAGCCTGGGGCGGCGCATCTCGGAAGCA
GCCGCGGCTAGAAAGGACTCGGTGGTGGGAGACGGCACGCCGCAGAGCCTGGTGCTGGAGCTGCTGCGTCCGTTG
AAGGAGGCTCTGGGCCCCGTGGGAACGCGGGCGTACGGGGCGCTTGTGTACTCCAACCTGGCCAACGCATCGACG
CAGCAGCACGACGTGATTCGCGCGGGCGACATCATGACGGTCCGCAATGCCAAGTTTCAGGGCAAGCACGGCGCA
ATGCATGCCAAATACTCTGTCGAGGTGGGAAAGCCGGACCATGTTGCCGTGGTGGCGGAATGGGACGGCACCAAG
AAGAAGGTGAGAGCGTGGGAGCAAGGGCGTGAGAGCAAAAAGGTCAAGCTGGAGAGCTTCAAGCTCGACGACTTG
CGCAGCGGAGAGGTCAAGATTTGGCGCGTGGTGCCGCGCAGCTGGGTGGGCTGGGAGATGTGA
Transcript >OphauB2|2567
ATGGCGGCGCCGCTCCGGGTCAAGTCTCTATACGAGTATTCGTCGCCGCATGAAGACGACCTCAACTTTGCCGTC
GGCCAAGTCATTACTGTCACTGACGACGACGACCCAGAATGGTACGGTGGCGAATATATTGACCAGGATGGCGTA
AAGCAGGAAGGGATTTTTCCTCGCAATTTTGTCGAGAAGTTTGAGCCAACTGCGCCGCCTCGGCCGGCAAGAAGT
CGCCCCAAGAAGGAATCCGAGGCCGCTCATGAAGCAACTGCGGCGCCAGCTCCGCCGCTGCCGGCCAAGGATGAT
GACACACAAGCGCAGCAGCCGGATGCCGAGACAACACTGGCACCAGCTGAAGCTGCGTCTGCCGATGCCCCCATT
CCTCTTCCATCTCAGCCTGACGAGCCTGCTCCGACCATGACGTCGGCACCGGCAGCGCCCAAGACAAGCGAGCCG
CGAACAATAGGTGCTCCGCCTGCTTCTCCTGCCACCAAGATGAAGCCTTCAGCTCCGCCTCCCGTTTCCGAGAAG
CCTGCCAGTAGTTCGTTCAAGGACCGCATCGCCGCATTTAATAAAGCTGCTGCGCCGCCGATAGCTCCCTTCAAA
CCCGGCGGCCTCGGCGGTGGTAGCGGTAGCTCCACCTTTATCAAGAAGCCGTTTGTTGCTCCTCCGCCAAGTCGA
AATGCCTATGTTGCTCCTCCTCGTGACCCGCCTACGCCGACGGTCTATAAGCGCCAAGAGGATCCTGAGATTAGG
GAGCGTGAAGCTCAAAATATGCAGAATGCTGAAAAGGCTGGCCTCGTTCCAGCCGACCAGGCTCATGGCGGTGCA
GACCAAGATCAACCAAAGCCTACCAGCCTCAAGGAACGGATTGCTCTCCTCCAAAAGCAGCAGATGGAGCAAGCG
TCACGCCACGCCGAGGCTGCGGCAAAGAAGGAGAAGCCAAAGAAGCCTCCCAAGAAGCGAAGCGAATCTACCCCT
TCGGTTGAAGCTGTCCAGGAAGCGATTGAGGGCGGCCCTCCTGTCGTTCCGGAGCGTGCGGTGGCTGAAGACACC
GGCACACCTACAGAAGCACGACCTACAGTAAAGGCTCCACCTGCTCCTCGTCGTAAATCATCCAAAGGGCCCACG
CATGAAAGTGTCCATGACGGTAACGAAGCCGACATGTCGGGCGCTGGCGACACGACTGAGGACCAGGACGACACG
ACTGAGCGTGAGGACAGCGACGGGACACCACGACATGTTTCTCGGGCTGACACAACATCTACAATGGCCTCGGGT
GCCAAAGAAGAAACTGATGACGACGCAACTGCTGAGGCAGAGGGCGAGGACGAAATTGACCCGGAAATCAGGCGC
AAAGAAGAGCTGCGAGCACGAATGGCAAAGATGAGCGGAGGGATGGGCTTTCACGGCATGTTTGGCGGACCCATG
GCTCCCGTGGTACCTGCAACGCCCAAAAAGAAGGAAGCAAAAGCAGAAGGCTCGGGCTCTACTGCCGATGGGGGC
GAAGCAGCAGGATCGAGCACATACATTGCCCCTCCGATTGCAACGCCCATGGCTCTCCCGGGCTTTGGAGGGCCG
AGGCAGGCTGACGAGGAAGAAGCTGGAGGCTCGTCAAGAGCGCCTCCTCCGGCATTGCCAGTGCGGTCAGCCACT
GAGGACAGGATGAATCGGGCAGACGAGAGCGAGCAAGATGACGAGGAAGACGAGGCCGCAACGCCGGCCCCGGTA
GCGGAGCCCCAATCACCCAGCGCACTCCTGGCAGGGTCTGGCAGTCGTGCAGCGCCTCGTGCCGTGCCAGCAGAG
GGTCGGCCAGTGCTTGGGATAGCGACCATGGACGCCAAATCTGCTAATGACGGATTCGAGTCGGACGACGAAATG
TCGGGGGGGGCACGTGAGGCAGATGTGCCCAATGTGAGCGCGGCGGCTGCACGATCCCCCCCAATGCTACCCCAG
GCGGTGCAATCGCCAGGAGCCTCTGGGCGCTCGCCACCACTGTCGCCTCAAGGAGAGGACACATCGCCAACGTCA
CCCAGTGCGCCGACACATCACCGCAACAGCAGGCTTCCGCCTCCAGTGCCGGGATCTGCGCCTGCGCTTCCTCCT
GCTCACACACGCCCCCCACCGCCGCCACCCCCTGGCGGCCTGCTCAGGCGCCAGTCGACGGCAGATAGTCCTGTG
GCCCCAAGCGCGCCAGTGCGGCCTCTGCAGGCTGGGCAAGACAATGACGGGGAGGTGACTGAGTATGAAGGCGAC
TACGATACGGACATTGCGTCGTCGGTCCCACACAAGGATGCCCTCAAGTCGAGCCAGGAGCAAGGCACGGTGCAG
TCGCCGGTAGCGGAAGCCCCAAGGGCACAGCCACCGCCACTGCCGTCAGCCTCGGCCCCTCGGGCGGTGCCGCCA
CCTGTGCCTGTAGGCTCGTCCTCGGACAGCAGCAAACGGCGCTCCATTGACGCACCCCGGGCCGCGCCGCCGCCA
CCGCCACCTACAATCAAGGAAGGGACTGGGCATGATGAGGCTGGCATGGACTCGTACAACTACGCAAATGCCTCT
CATGCAGCAGCCACGTCTGGCTTTAGTCATCGCACGCCCAAGATTGAAGAGGAGGCACCGCGCTCGCCTGCCGTG
TCACCTGTGGAGCGGAGAGCGCCGCCAGGCAATGGGCGTGGCAGGCCATCCATGGACGTGCCGAGGACCAGCATG
AGCAACCGTCGATCCGTCGACTTGCATCGTCCATCCATGGAATCGGGCTTCATCGCCAATGACATTGACTTGGCG
GTGCAGAGTGGGTGGTGGAAGCAGGCCAACCAGGTGCCTCCGGTGCTCCAGGGGCGGCGGGACATTTGTTTTGAG
TGCGCCGAGTCGACGTCAACCAACCAAGGGGCCAAGACGGTGACGACGCGCGAGATTGCGGTGCTCTACCAGGAC
TACTCGCAGACGATTTTGACGGTGCGGTTTGACCCGTACGACCCGTCAGACGTGGAGCTGGAGCAGCGCCACGAG
TCTCCTCCGCGGGCGCTGCGCCAAGACCAAATGGAACAGTACTACGACAGCCTGGGGCGGCGCATCTCGGAAGCA
GCCGCGGCTAGAAAGGACTCGGTGGTGGGAGACGGCACGCCGCAGAGCCTGGTGCTGGAGCTGCTGCGTCCGTTG
AAGGAGGCTCTGGGCCCCGTGGGAACGCGGGCGTACGGGGCGCTTGTGTACTCCAACCTGGCCAACGCATCGACG
CAGCAGCACGACGTGATTCGCGCGGGCGACATCATGACGGTCCGCAATGCCAAGTTTCAGGGCAAGCACGGCGCA
ATGCATGCCAAATACTCTGTCGAGGTGGGAAAGCCGGACCATGTTGCCGTGGTGGCGGAATGGGACGGCACCAAG
AAGAAGGTGAGAGCGTGGGAGCAAGGGCGTGAGAGCAAAAAGGTCAAGCTGGAGAGCTTCAAGCTCGACGACTTG
CGCAGCGGAGAGGTCAAGATTTGGCGCGTGGTGCCGCGCAGCTGGGTGGGCTGGGAGATGTGA
Gene >OphauB2|2567
ATGGCGGCGCCGCTCCGGGTCAAGTCTCTATACGAGTATTCGTCGCCGCATGAAGACGACCTCAACTTTGCCGTC
GGCCAAGTCATTACTGTCACTGACGACGACGACCCAGAATGGTACGGTGGCGAATATATTGACCAGGATGGCGTA
AAGCAGGAAGGGATTTTTCCTCGCAATTTTGTCGAGAAGTTTGAGCCAACTGCGCCGCCTCGGCCGGCAAGAAGT
CGCCCCAAGAAGGAATCCGAGGCCGCTCATGAAGCAACTGCGGCGCCAGCTCCGCCGCTGCCGGCCAAGGATGAT
GACACACAAGCGCAGCAGCCGGATGCCGAGACAACACTGGCACCAGCTGAAGCTGCGTCTGCCGATGCCCCCATT
CCTCTTCCATCTCAGCCTGACGAGCCTGCTCCGACCATGACGTCGGCACCGGCAGCGCCCAAGACAAGCGAGCCG
CGAACAATAGGTGCTCCGCCTGCTTCTCCTGCCACCAAGATGAAGCCTTCAGCTCCGCCTCCCGTTTCCGAGAAG
CCTGCCAGTAGTTCGTTCAAGGACCGCATCGCCGCATTTAATAAAGCTGCTGCGCCGCCGATAGCTCCCTTCAAA
CCCGGCGGCCTCGGCGGTGGTAGCGGTAGCTCCACCTTTATCAAGAAGCCGTTTGTTGCTCCTCCGCCAAGTCGA
AATGCCTATGTTGCTCCTCCTCGTGACCCGCCTACGCCGACGGTCTATAAGCGCCAAGAGGATCCTGAGATTAGG
GAGCGTGAAGCTCAAAATATGCAGAATGCTGAAAAGGCTGGCCTCGTTCCAGCCGACCAGGCTCATGGCGGTGCA
GACCAAGATCAACCAAAGCCTACCAGCCTCAAGGAACGGATTGCTCTCCTCCAAAAGCAGCAGATGGAGCAAGCG
TCACGCCACGCCGAGGCTGCGGCAAAGAAGGAGAAGCCAAAGAAGCCTCCCAAGAAGCGAAGCGAATCTACCCCT
TCGGTTGAAGCTGTCCAGGAAGCGATTGAGGGCGGCCCTCCTGTCGTTCCGGAGCGTGCGGTGGCTGAAGACACC
GGCACACCTACAGAAGCACGACCTACAGTAAAGGCTCCACCTGCTCCTCGTCGTAAATCATCCAAAGGGCCCACG
CATGAAAGTGTCCATGACGGTAACGAAGCCGACATGTCGGGCGCTGGCGACACGACTGAGGACCAGGACGACACG
ACTGAGCGTGAGGACAGCGACGGGACACCACGACATGTTTCTCGGGCTGACACAACATCTACAATGGCCTCGGGT
GCCAAAGAAGAAACTGATGACGACGCAACTGCTGAGGCAGAGGGCGAGGACGAAATTGACCCGGAAATCAGGCGC
AAAGAAGAGCTGCGAGCACGAATGGCAAAGATGAGCGGAGGGATGGGCTTTCACGGCATGTTTGGCGGACCCATG
GCTCCCGTGGTACCTGCAACGCCCAAAAAGAAGGAAGCAAAAGCAGAAGGCTCGGGCTCTACTGCCGATGGGGGC
GAAGCAGCAGGATCGAGCACATACATTGCCCCTCCGATTGCAACGCCCATGGCTCTCCCGGGCTTTGGAGGGCCG
AGGCAGGCTGACGAGGAAGAAGCTGGAGGCTCGTCAAGAGCGCCTCCTCCGGCATTGCCAGTGCGGTCAGCCACT
GAGGACAGGATGAATCGGGCAGACGAGAGCGAGCAAGATGACGAGGAAGACGAGGCCGCAACGCCGGCCCCGGTA
GCGGAGCCCCAATGTAAAAAGACTTGTGCTACACCCACTATGCTCGAGGCAGTCTGCTAACTGAGGCGTAGCACC
CAGCGCACTCCTGGCAGGGTCTGGCAGTCGTGCAGCGCCTCGTGCCGTGCCAGCAGAGGGTAAGATTGACCCAAG
ACATGGCGGCGTGCAACTGACAAGAGGAGCAGGTCGGCCAGTGCTTGGGATAGCGACCATGGACGCCAAATCTGC
TAATGACGGATTCGAGTCGGACGACGAAATGTCGGGGGGGGCACGTGAGGCAGATGTGCCCAATGTGAGCGCGGC
GGCTGCACGATCCCCCCCAATGCTACCCCAGGCGGTGCAATCGCCAGGAGCCTCTGGGCGCTCGCCACCACTGTC
GCCTCAAGGAGAGGACACATCGCCAACGTCACCCAGTGCGCCGACACATCACCGCAACAGCAGGCTTCCGCCTCC
AGTGCCGGGATCTGCGCCTGCGCTTCCTCCTGCTCACACACGCCCCCCACCGCCGCCACCCCCTGGCGGCCTGCT
CAGGCGCCAGTCGACGGCAGATAGTCCTGTGGCCCCAAGCGCGCCAGTGCGGCCTCTGCAGGCTGGGCAAGACAA
TGACGGGGAGGTGACTGAGTATGAAGGCGACTACGATACGGACATTGCGTCGTCGGTCCCACACAAGGATGCCCT
CAAGTCGAGCCAGGAGCAAGGCACGGTGCAGTCGCCGGTAGCGGAAGCCCCAAGGGCACAGCCACCGCCACTGCC
GTCAGCCTCGGCCCCTCGGGCGGTGCCGCCACCTGTGCCTGTAGGCTCGTCCTCGGACAGCAGCAAACGGCGCTC
CATTGACGCACCCCGGGCCGCGCCGCCGCCACCGCCACCTACAATCAAGGAAGGGACTGGGCATGATGAGGCTGG
CATGGACTCGTACAACTACGCAAATGCCTCTCATGCAGCAGCCACGTCTGGCTTTAGTCATCGCACGCCCAAGAT
TGAAGAGGAGGCACCGCGCTCGCCTGCCGTGTCACCTGTGGAGCGGAGAGCGCCGCCAGGCAATGGGCGTGGCAG
GCCATCCATGGACGTGCCGAGGACCAGCATGAGCAACCGTCGATCCGTCGACTTGCATCGTCCATCCATGGAATC
GGGCTTCATCGCCAATGACATTGACTTGGCGGTGCAGAGTGGGTGGTGGAAGCAGGCCAACCAGGTGCCTCCGGT
GCTCCAGGGGCGGCGGGACATTTGTTTTGAGTGCGCCGAGTCGACGTCAACCAACCAAGGGGCCAAGACGGTGAC
GACGCGCGAGATTGCGGTGCTCTACCAGGACTACTCGCAGACGATTTTGACGGTGCGGTTTGACCCGTACGACCC
GTCAGACGTGGAGCTGGAGCAGCGCCACGAGTCTCCTCCGCGGGCGCTGCGCCAAGACCAAATGGAACAGTACTA
CGACAGCCTGGGGCGGCGCATCTCGGAAGCAGCCGCGGCTAGAAAGGACTCGGTGGTGGGAGACGGCACGCCGCA
GAGCCTGGTGCTGGAGCTGCTGCGTCCGTTGAAGGAGGCTCTGGGCCCCGTGGGAACGCGGGCGTACGGGGCGCT
TGTGTACTCCAACCTGGCCAACGCATCGACGCAGCAGCACGACGTGATTCGCGCGGGCGACATCATGACGGTCCG
CAATGCCAAGTTTCAGGGCAAGCACGGCGCAATGCATGCCAAATACTCTGTCGAGGTGGGAAAGCCGGACCATGT
TGCCGTGGTGGCGGAATGGGACGGCACCAAGAAGAAGGTGAGAGCGTGGGAGCAAGGGCGTGAGAGCAAAAAGGT
CAAGCTGGAGAGCTTCAAGCTCGACGACTTGCGCAGCGGAGAGGTCAAGATTTGGCGCGTGGTGCCGCGCAGCTG
GGTGGGCTGGGAGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail