Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2561
Gene name
LocationContig_181:2591..3696
Strand+
Gene length (bp)1105
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 8.4E-40 37 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USP0|EI2BA_SCHPO Translation initiation factor eIF-2B subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif221 PE=3 SV=1 17 307 1.0E-49
sp|P14741|EI2BA_YEAST Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN3 PE=1 SV=1 16 324 1.0E-48
sp|Q54I81|EI2BA_DICDI Translation initiation factor eIF-2B subunit alpha OS=Dictyostelium discoideum GN=eif2b1 PE=3 SV=1 17 322 5.0E-34
sp|Q64270|EI2BA_RAT Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus GN=Eif2b1 PE=2 SV=1 17 322 2.0E-33
sp|Q5RAR0|EI2BA_PONAB Translation initiation factor eIF-2B subunit alpha OS=Pongo abelii GN=EIF2B1 PE=2 SV=2 17 322 4.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USP0|EI2BA_SCHPO Translation initiation factor eIF-2B subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif221 PE=3 SV=1 17 307 1.0E-49
sp|P14741|EI2BA_YEAST Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN3 PE=1 SV=1 16 324 1.0E-48
sp|Q54I81|EI2BA_DICDI Translation initiation factor eIF-2B subunit alpha OS=Dictyostelium discoideum GN=eif2b1 PE=3 SV=1 17 322 5.0E-34
sp|Q64270|EI2BA_RAT Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus GN=Eif2b1 PE=2 SV=1 17 322 2.0E-33
sp|Q5RAR0|EI2BA_PONAB Translation initiation factor eIF-2B subunit alpha OS=Pongo abelii GN=EIF2B1 PE=2 SV=2 17 322 4.0E-32
sp|Q14232|EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens GN=EIF2B1 PE=1 SV=1 17 322 4.0E-32
sp|Q4R4V8|EI2BA_MACFA Translation initiation factor eIF-2B subunit alpha OS=Macaca fascicularis GN=EIF2B1 PE=2 SV=1 17 322 1.0E-31
sp|Q99LC8|EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus GN=Eif2b1 PE=1 SV=1 17 322 1.0E-31
sp|Q0IIF2|EI2BA_BOVIN Translation initiation factor eIF-2B subunit alpha OS=Bos taurus GN=EIF2B1 PE=2 SV=1 19 322 1.0E-30
sp|P34604|EI2BA_CAEEL Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans GN=ZK1098.4 PE=1 SV=1 20 322 3.0E-26
sp|Q9V281|R15PI_PYRAB Ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01930 PE=3 SV=1 99 320 2.0E-17
sp|Q5JFM9|R15PI_THEKO Ribose 1,5-bisphosphate isomerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0185 PE=1 SV=1 99 319 2.0E-16
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 57 320 2.0E-16
sp|Q8U4G6|R15PI_PYRFU Ribose 1,5-bisphosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0122 PE=3 SV=2 55 320 2.0E-15
sp|O28242|R15PI_ARCFU Ribose 1,5-bisphosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2037 PE=3 SV=1 95 312 4.0E-15
sp|Q57586|R15PI_METJA Ribose 1,5-bisphosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0122 PE=3 SV=1 48 322 7.0E-15
sp|Q54FM3|EI2BD_DICDI Translation initiation factor eIF-2B subunit delta OS=Dictyostelium discoideum GN=eif2b4 PE=3 SV=1 108 320 2.0E-14
sp|Q9UYB6|EI2BL_PYRAB Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB15920 PE=3 SV=1 116 311 5.0E-14
sp|Q3T058|EI2BD_BOVIN Translation initiation factor eIF-2B subunit delta OS=Bos taurus GN=EIF2B4 PE=2 SV=1 114 318 7.0E-13
sp|Q8U3J1|EI2BL_PYRFU Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0475 PE=3 SV=1 116 311 2.0E-12
sp|Q63186|EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus GN=Eif2b4 PE=2 SV=1 114 318 1.0E-11
sp|Q61749|EI2BD_MOUSE Translation initiation factor eIF-2B subunit delta OS=Mus musculus GN=Eif2b4 PE=1 SV=2 114 318 1.0E-11
sp|Q3ABU6|MTNA_CARHZ Methylthioribose-1-phosphate isomerase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mtnA PE=3 SV=1 61 313 1.0E-11
sp|Q90511|EI2BB_TAKRU Translation initiation factor eIF-2B subunit beta OS=Takifugu rubripes GN=eif2b2 PE=3 SV=1 125 322 2.0E-11
sp|Q54EY2|EI2BB_DICDI Translation initiation factor eIF-2B subunit beta OS=Dictyostelium discoideum GN=eif2b2 PE=3 SV=1 126 323 2.0E-11
sp|Q9UI10|EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens GN=EIF2B4 PE=1 SV=2 79 318 3.0E-11
sp|Q8TUJ1|MTNA_METAC Putative methylthioribose-1-phosphate isomerase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0076 PE=3 SV=1 63 314 4.0E-11
sp|Q7UF90|MTNA_RHOBA Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mtnA PE=3 SV=1 187 307 1.0E-10
sp|O58185|EI2BL_PYRHO Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0440 PE=1 SV=1 116 311 1.0E-10
sp|P41111|EI2BD_RABIT Translation initiation factor eIF-2B subunit delta OS=Oryctolagus cuniculus GN=EIF2B4 PE=2 SV=2 79 318 2.0E-10
sp|P49770|EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens GN=EIF2B2 PE=1 SV=3 125 327 2.0E-10
sp|Q5E9B4|EI2BB_BOVIN Translation initiation factor eIF-2B subunit beta OS=Bos taurus GN=EIF2B2 PE=2 SV=1 125 327 3.0E-10
sp|B0JPT8|MTNA_MICAN Methylthioribose-1-phosphate isomerase OS=Microcystis aeruginosa (strain NIES-843) GN=mtnA PE=3 SV=1 38 312 4.0E-10
sp|B7IFW5|MTNA_THEAB Methylthioribose-1-phosphate isomerase OS=Thermosipho africanus (strain TCF52B) GN=mtnA PE=3 SV=1 100 313 4.0E-10
sp|Q28690|EI2BB_RABIT Translation initiation factor eIF-2B subunit beta OS=Oryctolagus cuniculus GN=EIF2B2 PE=1 SV=1 125 322 4.0E-10
sp|Q99LD9|EI2BB_MOUSE Translation initiation factor eIF-2B subunit beta OS=Mus musculus GN=Eif2b2 PE=1 SV=1 125 327 6.0E-10
sp|Q62818|EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus GN=Eif2b2 PE=2 SV=1 125 327 7.0E-10
sp|A5UQK6|MTNA_ROSS1 Methylthioribose-1-phosphate isomerase OS=Roseiflexus sp. (strain RS-1) GN=mtnA PE=3 SV=1 213 313 2.0E-09
sp|D4GV73|R15PI_HALVD Ribose 1,5-bisphosphate isomerase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_0966 PE=1 SV=1 102 322 2.0E-09
sp|Q66E16|MTNA_YERPS Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mtnA PE=3 SV=1 107 314 2.0E-09
sp|B2K633|MTNA_YERPB Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mtnA PE=3 SV=1 107 314 2.0E-09
sp|A6LJM7|MTNA_THEM4 Methylthioribose-1-phosphate isomerase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mtnA PE=3 SV=1 100 313 3.0E-09
sp|B0TH58|MTNA_HELMI Methylthioribose-1-phosphate isomerase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mtnA PE=3 SV=1 192 314 3.0E-09
sp|Q113K5|MTNA_TRIEI Methylthioribose-1-phosphate isomerase OS=Trichodesmium erythraeum (strain IMS101) GN=mtnA PE=3 SV=1 192 311 4.0E-09
sp|B1JIK3|MTNA_YERPY Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mtnA PE=3 SV=1 107 314 7.0E-09
sp|A4TPM9|MTNA_YERPP Methylthioribose-1-phosphate isomerase OS=Yersinia pestis (strain Pestoides F) GN=mtnA PE=3 SV=1 107 314 7.0E-09
sp|A9R2Z5|MTNA_YERPG Methylthioribose-1-phosphate isomerase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mtnA PE=3 SV=1 107 314 7.0E-09
sp|A7FLL1|MTNA_YERP3 Methylthioribose-1-phosphate isomerase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mtnA PE=3 SV=1 107 314 7.0E-09
sp|Q028S4|MTNA_SOLUE Methylthioribose-1-phosphate isomerase OS=Solibacter usitatus (strain Ellin6076) GN=mtnA PE=3 SV=1 99 321 8.0E-09
sp|A8YD90|MTNA_MICAE Methylthioribose-1-phosphate isomerase OS=Microcystis aeruginosa GN=mtnA PE=3 SV=1 192 312 8.0E-09
sp|B0C8J2|MTNA_ACAM1 Methylthioribose-1-phosphate isomerase OS=Acaryochloris marina (strain MBIC 11017) GN=mtnA PE=3 SV=1 193 318 1.0E-08
sp|Q9UT76|EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif222 PE=1 SV=1 127 325 1.0E-08
sp|Q5N076|MTNA_SYNP6 Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mtnA PE=3 SV=1 166 313 1.0E-08
sp|Q31LP7|MTNA_SYNE7 Methylthioribose-1-phosphate isomerase OS=Synechococcus elongatus (strain PCC 7942) GN=mtnA PE=3 SV=1 166 313 1.0E-08
sp|B1I2P1|MTNA_DESAP Methylthioribose-1-phosphate isomerase OS=Desulforudis audaxviator (strain MP104C) GN=mtnA PE=3 SV=1 192 313 2.0E-08
sp|A0LIZ1|MTNA_SYNFM Methylthioribose-1-phosphate isomerase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mtnA PE=3 SV=1 185 307 2.0E-08
sp|B7KZ66|MTNA_METC4 Methylthioribose-1-phosphate isomerase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=mtnA PE=3 SV=1 174 307 2.0E-08
sp|A7Z3X0|MTNA_BACMF Methylthioribose-1-phosphate isomerase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mtnA PE=3 SV=1 192 313 2.0E-08
sp|B9LBK4|MTNA_CHLSY Methylthioribose-1-phosphate isomerase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mtnA PE=3 SV=1 212 321 2.0E-08
sp|A9WGQ8|MTNA_CHLAA Methylthioribose-1-phosphate isomerase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mtnA PE=3 SV=1 212 321 2.0E-08
sp|B1ZL76|MTNA_METPB Methylthioribose-1-phosphate isomerase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=mtnA PE=3 SV=1 174 307 3.0E-08
sp|Q5FQK0|MTNA_GLUOX Methylthioribose-1-phosphate isomerase OS=Gluconobacter oxydans (strain 621H) GN=mtnA PE=3 SV=1 170 307 3.0E-08
sp|Q3Z937|MTNA_DEHM1 Methylthioribose-1-phosphate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mtnA PE=3 SV=1 99 307 3.0E-08
sp|Q2RKL8|MTNA_MOOTA Methylthioribose-1-phosphate isomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=mtnA PE=3 SV=1 187 313 3.0E-08
sp|Q57896|MTNA_METJA Putative methylthioribose-1-phosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0454 PE=3 SV=1 107 312 3.0E-08
sp|A5G9J7|MTNA_GEOUR Methylthioribose-1-phosphate isomerase OS=Geobacter uraniireducens (strain Rf4) GN=mtnA PE=3 SV=1 127 313 4.0E-08
sp|O27900|MTNA_METTH Putative methylthioribose-1-phosphate isomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1872 PE=3 SV=1 127 311 4.0E-08
sp|A6X8E9|MTNA_OCHA4 Methylthioribose-1-phosphate isomerase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mtnA PE=3 SV=1 170 319 4.0E-08
sp|B1XJK0|MTNA_SYNP2 Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mtnA PE=3 SV=2 192 311 4.0E-08
sp|Q8DK09|MTNA_THEEB Methylthioribose-1-phosphate isomerase OS=Thermosynechococcus elongatus (strain BP-1) GN=mtnA PE=3 SV=1 61 311 5.0E-08
sp|A7NFR2|MTNA_ROSCS Methylthioribose-1-phosphate isomerase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mtnA PE=3 SV=1 213 313 5.0E-08
sp|B3RLE6|MTNA_TRIAD Methylthioribose-1-phosphate isomerase OS=Trichoplax adhaerens GN=TRIADDRAFT_19292 PE=3 SV=1 192 318 5.0E-08
sp|A3DD27|MTNA_CLOTH Methylthioribose-1-phosphate isomerase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mtnA PE=3 SV=1 192 313 6.0E-08
sp|Q24UA0|MTNA_DESHY Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain Y51) GN=mtnA PE=3 SV=1 193 307 6.0E-08
sp|A8F3A3|MTNA1_PSELT Methylthioribose-1-phosphate isomerase 1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mtnA1 PE=3 SV=1 103 313 6.0E-08
sp|B8FRM1|MTNA_DESHD Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=mtnA PE=3 SV=1 193 307 6.0E-08
sp|P74497|MTNA_SYNY3 Methylthioribose-1-phosphate isomerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mtnA PE=3 SV=1 192 312 7.0E-08
sp|O67879|MTNA_AQUAE Methylthioribose-1-phosphate isomerase OS=Aquifex aeolicus (strain VF5) GN=mtnA PE=3 SV=1 151 314 7.0E-08
sp|A4J678|MTNA_DESRM Methylthioribose-1-phosphate isomerase OS=Desulfotomaculum reducens (strain MI-1) GN=mtnA PE=3 SV=1 192 313 7.0E-08
sp|O31662|MTNA_BACSU Methylthioribose-1-phosphate isomerase OS=Bacillus subtilis (strain 168) GN=mtnA PE=1 SV=1 192 313 8.0E-08
sp|B5ED21|MTNA_GEOBB Methylthioribose-1-phosphate isomerase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mtnA PE=3 SV=1 193 313 8.0E-08
sp|Q63GN3|MTNA1_BACCZ Methylthioribose-1-phosphate isomerase 1 OS=Bacillus cereus (strain ZK / E33L) GN=mtnA1 PE=3 SV=2 174 307 8.0E-08
sp|Q3AMB7|MTNA_SYNSC Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain CC9605) GN=mtnA PE=3 SV=1 174 313 9.0E-08
sp|C6E6Z4|MTNA_GEOSM Methylthioribose-1-phosphate isomerase OS=Geobacter sp. (strain M21) GN=mtnA PE=3 SV=1 193 313 1.0E-07
sp|A7HN79|MTNA_FERNB Methylthioribose-1-phosphate isomerase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mtnA PE=3 SV=1 100 313 1.0E-07
sp|A9VRK3|MTNA1_BACWK Methylthioribose-1-phosphate isomerase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=mtnA1 PE=3 SV=2 174 307 1.0E-07
sp|Q81IK7|MTNA1_BACCR Methylthioribose-1-phosphate isomerase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mtnA1 PE=3 SV=2 174 307 1.0E-07
sp|Q21S04|MTNA_RHOFT Methylthioribose-1-phosphate isomerase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mtnA PE=3 SV=1 193 307 1.0E-07
sp|Q0VPK6|MTNA_ALCBS Methylthioribose-1-phosphate isomerase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mtnA PE=3 SV=1 70 311 1.0E-07
sp|Q81ZC2|MTNA1_BACAN Methylthioribose-1-phosphate isomerase 1 OS=Bacillus anthracis GN=mtnA1 PE=3 SV=1 174 307 1.0E-07
sp|A0R946|MTNA1_BACAH Methylthioribose-1-phosphate isomerase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=mtnA1 PE=3 SV=2 174 307 1.0E-07
sp|A9BHC5|MTNA2_PETMO Methylthioribose-1-phosphate isomerase 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mtnA2 PE=3 SV=1 96 313 1.0E-07
sp|Q92TI2|MTNA_RHIME Methylthioribose-1-phosphate isomerase OS=Rhizobium meliloti (strain 1021) GN=mtnA PE=3 SV=1 170 319 1.0E-07
sp|A1JP09|MTNA_YERE8 Methylthioribose-1-phosphate isomerase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mtnA PE=3 SV=1 125 314 2.0E-07
sp|A6T656|MTNA_KLEP7 Methylthioribose-1-phosphate isomerase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mtnA PE=3 SV=1 127 314 2.0E-07
sp|A4W7Z1|MTNA_ENT38 Methylthioribose-1-phosphate isomerase OS=Enterobacter sp. (strain 638) GN=mtnA PE=3 SV=1 187 321 2.0E-07
sp|Q7U4V1|MTNA_SYNPX Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain WH8102) GN=mtnA PE=3 SV=2 174 313 2.0E-07
sp|C6DCZ1|MTNA_PECCP Methylthioribose-1-phosphate isomerase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mtnA PE=3 SV=1 187 314 2.0E-07
sp|C6C0F7|MTNA_DESAD Methylthioribose-1-phosphate isomerase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=mtnA PE=3 SV=1 192 313 2.0E-07
sp|A5W7G2|MTNA_PSEP1 Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mtnA PE=3 SV=1 192 307 3.0E-07
sp|A8GAB1|MTNA_SERP5 Methylthioribose-1-phosphate isomerase OS=Serratia proteamaculans (strain 568) GN=mtnA PE=3 SV=1 107 314 3.0E-07
sp|B1J5G5|MTNA_PSEPW Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain W619) GN=mtnA PE=3 SV=1 192 307 3.0E-07
sp|B4UIU8|MTNA_ANASK Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter sp. (strain K) GN=mtnA PE=3 SV=1 192 307 3.0E-07
sp|A4XKS3|MTNA_CALS8 Methylthioribose-1-phosphate isomerase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mtnA PE=3 SV=1 6 313 4.0E-07
sp|A5D1G8|MTNA_PELTS Methylthioribose-1-phosphate isomerase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mtnA PE=3 SV=1 101 313 4.0E-07
sp|B0KTX5|MTNA_PSEPG Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain GB-1) GN=mtnA PE=3 SV=1 192 307 4.0E-07
sp|B7NGT8|MTNA_ECOLU Methylthioribose-1-phosphate isomerase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mtnA PE=3 SV=1 170 307 5.0E-07
sp|B7MMH6|MTNA_ECO45 Methylthioribose-1-phosphate isomerase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mtnA PE=3 SV=1 170 307 5.0E-07
sp|A8F7V1|MTNA2_PSELT Methylthioribose-1-phosphate isomerase 2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mtnA2 PE=3 SV=1 174 313 5.0E-07
sp|Q1ISH2|MTNA_KORVE Methylthioribose-1-phosphate isomerase OS=Koribacter versatilis (strain Ellin345) GN=mtnA PE=3 SV=1 202 313 5.0E-07
sp|Q3A2J8|MTNA_PELCD Methylthioribose-1-phosphate isomerase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mtnA PE=3 SV=1 192 314 5.0E-07
sp|Q6HP54|MTNA1_BACHK Methylthioribose-1-phosphate isomerase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mtnA1 PE=3 SV=2 174 307 5.0E-07
sp|B2J5P6|MTNA_NOSP7 Methylthioribose-1-phosphate isomerase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mtnA PE=3 SV=1 192 311 6.0E-07
sp|Q2IH96|MTNA_ANADE Methylthioribose-1-phosphate isomerase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mtnA PE=3 SV=1 192 307 6.0E-07
sp|Q1IDA4|MTNA_PSEE4 Methylthioribose-1-phosphate isomerase OS=Pseudomonas entomophila (strain L48) GN=mtnA PE=3 SV=1 166 307 6.0E-07
sp|A6V2Q6|MTNA_PSEA7 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain PA7) GN=mtnA PE=3 SV=1 192 307 6.0E-07
sp|A7MKX3|MTNA_CROS8 Methylthioribose-1-phosphate isomerase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mtnA PE=3 SV=1 93 314 6.0E-07
sp|Q9HZ65|MTNA_PSEAE Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mtnA PE=3 SV=1 192 307 7.0E-07
sp|Q02PX5|MTNA_PSEAB Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mtnA PE=3 SV=1 192 307 7.0E-07
sp|B7V9J7|MTNA_PSEA8 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=mtnA PE=3 SV=1 192 307 7.0E-07
sp|A6ULQ4|MTNA_SINMW Methylthioribose-1-phosphate isomerase OS=Sinorhizobium medicae (strain WSM419) GN=mtnA PE=3 SV=1 170 307 8.0E-07
sp|A9AYL1|MTNA_HERA2 Methylthioribose-1-phosphate isomerase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=mtnA PE=3 SV=2 101 313 8.0E-07
sp|B5YGA0|MTNA_THEYD Methylthioribose-1-phosphate isomerase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mtnA PE=3 SV=1 50 314 9.0E-07
sp|Q317L9|MTNA_DESAG Methylthioribose-1-phosphate isomerase OS=Desulfovibrio alaskensis (strain G20) GN=mtnA PE=3 SV=1 192 313 9.0E-07
sp|B4K8A4|MTNA_DROMO Methylthioribose-1-phosphate isomerase OS=Drosophila mojavensis GN=GI10562 PE=3 SV=1 103 320 1.0E-06
sp|B5XZW2|MTNA_KLEP3 Methylthioribose-1-phosphate isomerase OS=Klebsiella pneumoniae (strain 342) GN=mtnA PE=3 SV=1 127 314 1.0E-06
sp|Q65KK2|MTNA_BACLD Methylthioribose-1-phosphate isomerase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mtnA PE=3 SV=1 192 307 1.0E-06
sp|Q0ZB81|MTNA_BOMMO Methylthioribose-1-phosphate isomerase OS=Bombyx mori PE=2 SV=1 206 314 1.0E-06
sp|B1LC23|MTNA_THESQ Methylthioribose-1-phosphate isomerase OS=Thermotoga sp. (strain RQ2) GN=mtnA PE=3 SV=1 106 313 1.0E-06
sp|A5IIM2|MTNA_THEP1 Methylthioribose-1-phosphate isomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mtnA PE=3 SV=1 106 313 1.0E-06
sp|B1WQH2|MTNA_CYAA5 Methylthioribose-1-phosphate isomerase OS=Cyanothece sp. (strain ATCC 51142) GN=mtnA PE=3 SV=2 193 311 1.0E-06
sp|Q8YR82|MTNA_NOSS1 Methylthioribose-1-phosphate isomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mtnA PE=3 SV=1 192 311 1.0E-06
sp|B4JRX2|MTNA_DROGR Methylthioribose-1-phosphate isomerase OS=Drosophila grimshawi GN=GH21593 PE=3 SV=1 196 312 1.0E-06
sp|Q39ZK3|MTNA_GEOMG Methylthioribose-1-phosphate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mtnA PE=3 SV=1 96 313 2.0E-06
sp|Q3M785|MTNA_ANAVT Methylthioribose-1-phosphate isomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mtnA PE=3 SV=1 192 312 2.0E-06
sp|O58433|MTNA_PYRHO Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0702 PE=3 SV=1 192 313 2.0E-06
sp|A0L909|MTNA_MAGMM Methylthioribose-1-phosphate isomerase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mtnA PE=3 SV=1 212 307 2.0E-06
sp|Q2NFJ6|MTNA_METST Putative methylthioribose-1-phosphate isomerase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=Msp_1023 PE=3 SV=1 121 311 2.0E-06
sp|B2V8N9|MTNA_SULSY Methylthioribose-1-phosphate isomerase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=mtnA PE=3 SV=1 44 307 2.0E-06
sp|C0QUC0|MTNA_PERMH Methylthioribose-1-phosphate isomerase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mtnA PE=3 SV=1 192 307 2.0E-06
sp|Q4FZP2|MTNA_XENLA Methylthioribose-1-phosphate isomerase OS=Xenopus laevis GN=mri1 PE=2 SV=1 85 311 3.0E-06
sp|Q88M09|MTNA_PSEPK Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain KT2440) GN=mtnA PE=3 SV=1 192 307 3.0E-06
sp|Q29BB3|MTNA_DROPS Methylthioribose-1-phosphate isomerase OS=Drosophila pseudoobscura pseudoobscura GN=GA10928 PE=3 SV=1 212 321 3.0E-06
sp|B8DQQ9|MTNA_DESVM Methylthioribose-1-phosphate isomerase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=mtnA PE=3 SV=1 193 313 3.0E-06
sp|B4GYU1|MTNA_DROPE Methylthioribose-1-phosphate isomerase OS=Drosophila persimilis GN=GL27236 PE=3 SV=1 212 321 3.0E-06
sp|B4LWZ8|MTNA_DROVI Methylthioribose-1-phosphate isomerase OS=Drosophila virilis GN=GJ22917 PE=3 SV=1 196 323 3.0E-06
sp|Q9V9X4|MTNA_DROME Methylthioribose-1-phosphate isomerase OS=Drosophila melanogaster GN=CG11334 PE=2 SV=1 212 321 4.0E-06
sp|B9LZ20|MTNA_GEODF Methylthioribose-1-phosphate isomerase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mtnA PE=3 SV=1 192 313 4.0E-06
sp|B4QSM8|MTNA_DROSI Methylthioribose-1-phosphate isomerase OS=Drosophila simulans GN=GD16414 PE=3 SV=1 212 321 4.0E-06
sp|B3P538|MTNA_DROER Methylthioribose-1-phosphate isomerase OS=Drosophila erecta GN=GG11866 PE=3 SV=1 212 321 4.0E-06
sp|B4I029|MTNA_DROSE Methylthioribose-1-phosphate isomerase OS=Drosophila sechellia GN=GM12085 PE=3 SV=1 212 321 4.0E-06
sp|B4PNE2|MTNA_DROYA Methylthioribose-1-phosphate isomerase OS=Drosophila yakuba GN=GE23315 PE=3 SV=1 212 321 4.0E-06
sp|Q9X013|MTNA_THEMA Methylthioribose-1-phosphate isomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mtnA PE=1 SV=1 106 313 4.0E-06
sp|Q8U178|MTNA_PYRFU Putative methylthioribose-1-phosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1349 PE=3 SV=1 192 321 5.0E-06
sp|Q3K8T8|MTNA_PSEPF Methylthioribose-1-phosphate isomerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=mtnA PE=3 SV=1 192 307 5.0E-06
sp|Q3AWF5|MTNA_SYNS9 Methylthioribose-1-phosphate isomerase OS=Synechococcus sp. (strain CC9902) GN=mtnA PE=3 SV=1 174 307 5.0E-06
sp|A6LE92|MTNA_PARD8 Methylthioribose-1-phosphate isomerase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mtnA PE=3 SV=2 111 307 5.0E-06
sp|A7RF00|MTNA_NEMVE Methylthioribose-1-phosphate isomerase OS=Nematostella vectensis GN=v1g237765 PE=3 SV=1 193 319 5.0E-06
sp|Q0AYV4|MTNA_SYNWW Methylthioribose-1-phosphate isomerase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mtnA PE=3 SV=1 103 313 6.0E-06
sp|A4VLZ8|MTNA_PSEU5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=mtnA PE=3 SV=2 170 307 6.0E-06
sp|B8J4S7|MTNA_DESDA Methylthioribose-1-phosphate isomerase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=mtnA PE=3 SV=1 100 313 6.0E-06
sp|Q7NP62|MTNA_GLOVI Methylthioribose-1-phosphate isomerase OS=Gloeobacter violaceus (strain PCC 7421) GN=mtnA PE=3 SV=1 193 312 6.0E-06
sp|C1DRQ7|MTNA_AZOVD Methylthioribose-1-phosphate isomerase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mtnA PE=3 SV=1 192 307 7.0E-06
sp|Q2SE63|MTNA_HAHCH Methylthioribose-1-phosphate isomerase OS=Hahella chejuensis (strain KCTC 2396) GN=mtnA PE=3 SV=1 193 310 7.0E-06
sp|Q9YE84|MTNA_AERPE Putative methylthioribose-1-phosphate isomerase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_0686 PE=3 SV=1 185 313 7.0E-06
sp|B4NG41|MTNA_DROWI Methylthioribose-1-phosphate isomerase OS=Drosophila willistoni GN=GK22419 PE=3 SV=1 212 311 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2561
MPSARPASAEALLASTDFDIVATYNNLLMSDPALTKPVAAIHALIGLLNSVSITTIHETVETLKVHAKRLKNSVA
IPAPLTAGTDLFIQFLISSLNQPGGDFDALLQHLLQNSRLFAHRAIAAREGVAARGYKYVGEGKTVLTLGASRCV
TALLQVAVERRGGGAMFRVVYVRDDTRKAENDALVAKLRGLGIPVAEVAMSSVAHVMGLLHQVDTVIVGAEAVTE
NGGIISRMGTYQIAKLAFSNRPKLPFYVATETHKFSRDFPLGQRDIDQKVLDFSAEISSKQPKDAVDYTPPEFIT
GLITETGTHLPSYVPMKLLETYDDSLFTD*
Coding >OphauB2|2561
ATGCCGTCTGCACGCCCAGCTTCGGCGGAAGCTCTCCTCGCTTCGACCGACTTTGACATCGTAGCAACATACAAT
AATCTCCTCATGTCTGACCCCGCTCTCACCAAGCCCGTGGCTGCCATTCACGCCCTCATTGGCCTGCTCAACTCT
GTCTCCATAACCACGATTCACGAAACCGTCGAGACTCTCAAAGTCCACGCCAAACGCCTCAAAAACTCGGTCGCA
ATCCCGGCTCCTCTTACTGCCGGCACTGACCTCTTCATCCAGTTCCTCATCTCGTCGCTTAACCAGCCAGGTGGA
GACTTTGATGCTCTTCTACAGCACCTACTCCAAAATAGCCGTCTCTTTGCCCATCGCGCTATAGCAGCCCGCGAG
GGCGTCGCTGCCAGAGGCTACAAGTATGTTGGAGAGGGCAAGACGGTCCTCACGCTTGGCGCCTCGAGATGCGTC
ACGGCTTTGCTCCAAGTTGCTGTTGAGCGTCGAGGCGGCGGCGCCATGTTTCGTGTCGTTTATGTGCGTGACGAT
ACTCGCAAAGCCGAAAACGACGCCTTGGTTGCCAAGTTGCGCGGTCTCGGCATCCCTGTGGCCGAAGTGGCCATG
TCTTCGGTAGCCCACGTCATGGGCTTGCTACACCAGGTCGACACTGTCATTGTGGGAGCCGAGGCTGTGACGGAA
AATGGTGGCATCATTTCTCGCATGGGCACCTATCAGATTGCAAAGCTAGCTTTTAGCAACCGACCCAAATTGCCT
TTTTACGTGGCCACCGAGACACACAAGTTCTCCCGCGACTTTCCCTTGGGCCAGCGTGATATTGACCAAAAGGTT
CTCGATTTTTCCGCCGAAATTTCCAGTAAACAACCCAAGGACGCTGTGGATTATACCCCTCCGGAATTCATCACG
GGCTTGATCACGGAGACGGGAACCCATTTACCCAGCTACGTTCCAATGAAGCTCTTGGAAACATATGACGATTCC
CTCTTTACTGATTAA
Transcript >OphauB2|2561
ATGCCGTCTGCACGCCCAGCTTCGGCGGAAGCTCTCCTCGCTTCGACCGACTTTGACATCGTAGCAACATACAAT
AATCTCCTCATGTCTGACCCCGCTCTCACCAAGCCCGTGGCTGCCATTCACGCCCTCATTGGCCTGCTCAACTCT
GTCTCCATAACCACGATTCACGAAACCGTCGAGACTCTCAAAGTCCACGCCAAACGCCTCAAAAACTCGGTCGCA
ATCCCGGCTCCTCTTACTGCCGGCACTGACCTCTTCATCCAGTTCCTCATCTCGTCGCTTAACCAGCCAGGTGGA
GACTTTGATGCTCTTCTACAGCACCTACTCCAAAATAGCCGTCTCTTTGCCCATCGCGCTATAGCAGCCCGCGAG
GGCGTCGCTGCCAGAGGCTACAAGTATGTTGGAGAGGGCAAGACGGTCCTCACGCTTGGCGCCTCGAGATGCGTC
ACGGCTTTGCTCCAAGTTGCTGTTGAGCGTCGAGGCGGCGGCGCCATGTTTCGTGTCGTTTATGTGCGTGACGAT
ACTCGCAAAGCCGAAAACGACGCCTTGGTTGCCAAGTTGCGCGGTCTCGGCATCCCTGTGGCCGAAGTGGCCATG
TCTTCGGTAGCCCACGTCATGGGCTTGCTACACCAGGTCGACACTGTCATTGTGGGAGCCGAGGCTGTGACGGAA
AATGGTGGCATCATTTCTCGCATGGGCACCTATCAGATTGCAAAGCTAGCTTTTAGCAACCGACCCAAATTGCCT
TTTTACGTGGCCACCGAGACACACAAGTTCTCCCGCGACTTTCCCTTGGGCCAGCGTGATATTGACCAAAAGGTT
CTCGATTTTTCCGCCGAAATTTCCAGTAAACAACCCAAGGACGCTGTGGATTATACCCCTCCGGAATTCATCACG
GGCTTGATCACGGAGACGGGAACCCATTTACCCAGCTACGTTCCAATGAAGCTCTTGGAAACATATGACGATTCC
CTCTTTACTGATTAA
Gene >OphauB2|2561
ATGCCGTCTGCACGCCCAGCTTCGGCGGAAGCTCTCCTCGCTTCGACCGACTTTGAGTACGCTCGCCAAGCTTCT
CCTTGCTTCGCCTACTCGTTGCCTCTTGGCTAATTAGCATCGCAGCATCGTAGCAACATACAATAATCTCCTCAT
GTCTGACCCCGCTCTCACCAAGCCCGTGGCTGCCATTCACGCCCTCATTGGCCTGCTCAACTCTGTCTCCATAAC
CACGATTCACGAAACCGTCGAGACTCTCAAAGTCCACGCCAAACGCCTCAAAAACTCGGTCGCAATCCCGGCTCC
TCTTACTGCCGGCACTGACCTCTTCATCCAGTTCCTCATCTCGTCGCTTAACCAGCCAGGTGGAGACTTTGATGC
TCTTCTACAGCACCTACTCCAAAATAGCCGTCTCTTTGCCCATCGCGCTATAGCAGCCCGCGAGGGCGTCGCTGC
CAGAGGCTACAAGTATGTTGGAGAGGGCAAGACGGTCCTCACGCTTGGCGCCTCGAGATGCGTCACGGCTTTGCT
CCAAGTTGCTGTTGAGCGTCGAGGCGGCGGCGCCATGTTTCGTGTCGTTTATGTGCGTGACGATACTCGCAAAGC
CGAAAACGACGCCTTGGTTGCCAAGTTGCGCGGTCTCGGCATCCCTGTGGCCGAAGTGGCCATGTCTTCGGTAGC
CCACGTCATGGGCTTGCTACACCAGGTCGACACTGTCATTGTGGGAGCCGAGGCTGTGACGGAAAATGGTGGCAT
CATTTCTCGCATGGGCACCTATCAGATTGCAAAGCTAGCTTTTAGCAACCGACCCAAATTGCCTTTTTACGTGGC
CACCGAGACACACAAGTTCTCCCGCGACTTTCCCTTGGGCCAGCGTGATATTGACCAAAAGGTTCTCGATTTTTC
CGCCGAAATTTCCAGTAAACAACCCAAGGACGCTGTGGATTATACCGTGAGTTTTAATCCTCTCATTTTTGCACA
CTACCCACTCACAGCTTCACAGCCTCCGGAATTCATCACGGGCTTGATCACGGAGACGGGAACCCATTTACCCAG
CTACGTTCCAATGAAGCTCTTGGAAACATATGACGATTCCCTCTTTACTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail