Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2559
Gene name
LocationContig_181:520..1168
Strand+
Gene length (bp)648
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6110
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3505
Ophiocordyceps australis map64 (Brazil) OphauB2|2559 (this protein)
Ophiocordyceps kimflemingae Ophio5|2506
Ophiocordyceps subramaniannii Hirsu2|3625

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2559
MVSSTAREHRTRIAAQEMRRGRSPPDTARCPPLQATALLPWQRYEQLYAEDAYLTSSLCVQAITTMHLIERYAAL
DKQLQSLGMGKQRRRLRKQLSLLRLQINEAAVQQRTILVRLSELYVQVHCHDTWGWVHGHGTMWCGYSLQQTAQR
CATSMSSLSTTSSHSTALNGASPEFVPAGQLPTRGRPEPFNHGAGDQEPGVAETCFSAQADGEAV*
Coding >OphauB2|2559
ATGGTGTCCAGCACAGCCAGAGAGCACCGCACACGCATAGCTGCACAAGAGATGCGCCGCGGCCGCAGCCCGCCA
GACACTGCAAGATGCCCGCCTCTGCAAGCCACGGCCCTGCTGCCCTGGCAGCGGTACGAGCAACTCTATGCCGAG
GATGCCTACTTGACCAGCTCCCTGTGTGTGCAGGCCATAACAACAATGCATCTGATTGAGCGCTACGCTGCACTC
GACAAACAGCTCCAGAGCCTTGGCATGGGCAAGCAGCGACGCAGACTGCGCAAGCAGCTCAGCTTGCTGCGTCTG
CAAATCAACGAGGCGGCGGTGCAACAGCGCACCATTCTTGTCCGACTGAGCGAGTTGTACGTCCAAGTCCACTGC
CACGACACCTGGGGCTGGGTACACGGCCACGGGACAATGTGGTGCGGATATAGCCTCCAACAAACAGCCCAAAGA
TGCGCCACTTCCATGTCGTCTCTTAGCACCACATCGAGCCATTCGACAGCCCTGAATGGCGCCTCCCCAGAGTTT
GTGCCGGCAGGCCAGCTGCCGACTCGAGGCCGTCCAGAGCCCTTTAACCATGGGGCCGGGGACCAAGAGCCCGGT
GTGGCTGAAACGTGCTTCTCGGCGCAGGCCGACGGAGAAGCGGTGTGA
Transcript >OphauB2|2559
ATGGTGTCCAGCACAGCCAGAGAGCACCGCACACGCATAGCTGCACAAGAGATGCGCCGCGGCCGCAGCCCGCCA
GACACTGCAAGATGCCCGCCTCTGCAAGCCACGGCCCTGCTGCCCTGGCAGCGGTACGAGCAACTCTATGCCGAG
GATGCCTACTTGACCAGCTCCCTGTGTGTGCAGGCCATAACAACAATGCATCTGATTGAGCGCTACGCTGCACTC
GACAAACAGCTCCAGAGCCTTGGCATGGGCAAGCAGCGACGCAGACTGCGCAAGCAGCTCAGCTTGCTGCGTCTG
CAAATCAACGAGGCGGCGGTGCAACAGCGCACCATTCTTGTCCGACTGAGCGAGTTGTACGTCCAAGTCCACTGC
CACGACACCTGGGGCTGGGTACACGGCCACGGGACAATGTGGTGCGGATATAGCCTCCAACAAACAGCCCAAAGA
TGCGCCACTTCCATGTCGTCTCTTAGCACCACATCGAGCCATTCGACAGCCCTGAATGGCGCCTCCCCAGAGTTT
GTGCCGGCAGGCCAGCTGCCGACTCGAGGCCGTCCAGAGCCCTTTAACCATGGGGCCGGGGACCAAGAGCCCGGT
GTGGCTGAAACGTGCTTCTCGGCGCAGGCCGACGGAGAAGCGGTGTGA
Gene >OphauB2|2559
ATGGTGTCCAGCACAGCCAGAGAGCACCGCACACGCATAGCTGCACAAGAGATGCGCCGCGGCCGCAGCCCGCCA
GACACTGCAAGATGCCCGCCTCTGCAAGCCACGGCCCTGCTGCCCTGGCAGCGGTACGAGCAACTCTATGCCGAG
GATGCCTACTTGACCAGCTCCCTGTGTGTGCAGGCCATAACAACAATGCATCTGATTGAGCGCTACGCTGCACTC
GACAAACAGCTCCAGAGCCTTGGCATGGGCAAGCAGCGACGCAGACTGCGCAAGCAGCTCAGCTTGCTGCGTCTG
CAAATCAACGAGGCGGCGGTGCAACAGCGCACCATTCTTGTCCGACTGAGCGAGTTGTACGTCCAAGTCCACTGC
CACGACACCTGGGGCTGGGTACACGGCCACGGGACAATGTGGTGCGGATATAGCCTCCAACAAACAGCCCAAAGA
TGCGCCACTTCCATGTCGTCTCTTAGCACCACATCGAGCCATTCGACAGCCCTGAATGGCGCCTCCCCAGAGTTT
GTGCCGGCAGGCCAGCTGCCGACTCGAGGCCGTCCAGAGCCCTTTAACCATGGGGCCGGGGACCAAGAGCCCGGT
GTGGCTGAAACGTGCTTCTCGGCGCAGGCCGACGGAGAAGCGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail