Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2543
Gene name
LocationContig_18:224391..226272
Strand-
Gene length (bp)1881
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 5.2E-13 190 253
PF00013 KH_1 KH domain 3.9E-15 288 352
PF00013 KH_1 KH domain 1.1E-14 401 463

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 189 469 4.0E-27
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 189 469 4.0E-27
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 189 469 7.0E-27
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 189 469 5.0E-26
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 189 473 8.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 189 469 4.0E-27
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 189 469 4.0E-27
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 189 469 7.0E-27
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 189 469 5.0E-26
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 189 473 8.0E-25
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 189 469 2.0E-23
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 189 437 5.0E-23
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 189 437 5.0E-23
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 200 472 2.0E-12
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 187 465 2.0E-12
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 190 465 1.0E-11
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 190 465 2.0E-11
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 190 465 4.0E-11
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 184 357 1.0E-10
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 184 357 3.0E-10
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 199 467 4.0E-10
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 199 465 6.0E-10
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 284 471 1.0E-09
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 199 360 2.0E-09
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 184 466 2.0E-09
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 199 360 5.0E-09
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 199 360 6.0E-09
sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 257 466 9.0E-09
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 184 466 5.0E-08
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 288 470 8.0E-08
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 184 466 9.0E-08
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 184 466 1.0E-07
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 288 470 1.0E-07
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 177 321 2.0E-07
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 288 457 2.0E-07
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 288 457 2.0E-07
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 288 457 2.0E-07
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 288 457 2.0E-07
sp|Q9SR13|FLK_ARATH Flowering locus K homology domain OS=Arabidopsis thaliana GN=FLK PE=1 SV=1 194 350 2.0E-07
sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 162 357 6.0E-07
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 397 465 8.0E-07
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 162 357 1.0E-06
sp|Q08CK7|IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio GN=igf2bp1 PE=1 SV=1 151 559 1.0E-06
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 279 454 6.0E-06
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 200 357 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2104
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3967
Ophiocordyceps australis map64 (Brazil) OphauB2|2543 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04316
Ophiocordyceps camponoti-rufipedis Ophun1|4960
Ophiocordyceps kimflemingae Ophio5|1157
Ophiocordyceps subramaniannii Hirsu2|2480

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2543
MAEPQPDIQSILAALASQRGPTQTPSQQPPGASAPAYPAPSASAPPPGSYPHPPPPGLPPYGGPAHHGLPAPSSS
GNVDLSALRPVNSGTLNFEDIMSQARAYAAGKGATSYDRPPTYNADPRSAERPYRTSRSRSPRADYHRDERRGGH
GRDHGRDRSYSPPPRGRPFSPRGGSARDRSPLRGADDNSETIQIEASLVGLIIGRQGENLRRIESESNCRVQFLA
ATDGGPFRQCRISGPRQRRAEVKAAIDRIIEDSGMGPLNRVPDKSRDTNRAGTAGLRDGEDHIQIMVPDRTVGLI
IGRGGETIRDLQERSGCHINIVGESKSVNGLRPVNLIGTVEATSRAKDFIMEIVDSDTRGDGPAGKKAAATAPVG
GGISGHVDIPNSLREAGGNDKINDAIYVPSDAVGMIIGRGGETIREMQNATGCKINVAQSSGPGEVQREIALIGA
RDSIARAKMAIEEKVEAVRQKSGGGGGGGGAGGGRGRGYQDLERGPGGSYAQQGANASTTANQTPQASTGDGPDP
YAQYGGYQNYLALWYQSLMYQQQQQQQQGGQGAPAPGA*
Coding >OphauB2|2543
ATGGCAGAACCTCAACCAGATATCCAATCCATTCTTGCTGCACTGGCATCCCAGCGTGGCCCGACGCAGACGCCA
AGCCAGCAGCCTCCCGGCGCATCGGCACCTGCATACCCTGCTCCATCTGCTTCGGCGCCACCGCCTGGCTCCTAC
CCCCACCCTCCGCCCCCTGGCTTGCCTCCGTATGGCGGCCCAGCCCATCATGGCTTACCTGCTCCGTCTTCAAGC
GGCAATGTCGACTTGAGCGCTCTTCGCCCTGTAAACTCGGGAACCCTTAATTTTGAAGACATCATGTCCCAAGCA
CGAGCCTACGCGGCCGGAAAAGGAGCTACTTCATACGATCGCCCACCCACTTACAATGCCGATCCCCGAAGCGCG
GAGCGACCATACCGAACCTCGAGATCCCGCTCCCCACGGGCCGACTACCACAGAGACGAGCGCCGTGGTGGTCAC
GGTCGCGATCACGGCCGCGATAGATCTTATTCTCCTCCACCCCGCGGTCGTCCCTTTTCGCCTCGCGGAGGCAGT
GCTCGGGACAGATCACCTTTGCGAGGCGCCGACGATAATTCGGAGACTATTCAAATCGAGGCCAGCCTTGTGGGC
TTAATTATTGGTCGCCAAGGCGAGAATCTTCGACGCATTGAATCCGAGTCCAACTGTAGGGTGCAGTTTCTTGCT
GCCACGGATGGAGGTCCTTTTAGACAATGCAGAATATCTGGACCGCGGCAGCGTCGTGCCGAGGTCAAGGCAGCC
ATTGATCGTATCATAGAGGATAGTGGCATGGGTCCCCTGAACCGAGTGCCCGACAAGTCACGAGACACCAATAGA
GCGGGCACAGCCGGCCTCCGAGACGGCGAAGATCACATTCAAATCATGGTGCCAGATCGCACTGTTGGACTAATT
ATTGGTCGCGGAGGTGAGACTATTCGTGACCTCCAAGAACGCTCGGGATGTCACATAAACATTGTTGGAGAGTCC
AAAAGTGTCAATGGCCTCCGACCGGTAAATCTAATAGGCACCGTCGAAGCTACGTCTCGTGCCAAGGACTTCATC
ATGGAGATTGTCGATAGTGATACAAGAGGAGACGGTCCTGCTGGGAAGAAGGCGGCCGCCACGGCCCCCGTTGGC
GGTGGAATAAGCGGGCATGTCGACATACCTAATTCCTTGAGGGAAGCAGGCGGAAACGACAAGATTAATGATGCC
ATATATGTTCCTTCAGATGCTGTTGGAATGATTATAGGAAGAGGCGGCGAAACAATTCGTGAGATGCAAAACGCC
ACAGGGTGCAAAATCAACGTGGCCCAGTCTTCAGGTCCGGGAGAAGTGCAGAGAGAGATTGCTCTTATTGGTGCA
CGCGATAGCATAGCTCGCGCCAAAATGGCCATTGAGGAAAAGGTTGAAGCAGTGCGCCAGAAGAGCGGTGGCGGC
GGTGGCGGCGGCGGCGCTGGTGGCGGTCGTGGCCGGGGCTACCAGGACTTGGAACGAGGTCCTGGAGGTTCCTAT
GCGCAACAAGGCGCAAATGCGTCTACTACAGCTAACCAGACGCCTCAGGCGTCGACAGGTGATGGTCCTGATCCG
TATGCACAATACGGCGGATACCAGAACTATCTTGCTCTCTGGTATCAGTCATTAATGTACCAGCAACAACAACAG
CAACAGCAAGGCGGACAAGGCGCACCCGCCCCTGGAGCCTAG
Transcript >OphauB2|2543
ATGGCAGAACCTCAACCAGATATCCAATCCATTCTTGCTGCACTGGCATCCCAGCGTGGCCCGACGCAGACGCCA
AGCCAGCAGCCTCCCGGCGCATCGGCACCTGCATACCCTGCTCCATCTGCTTCGGCGCCACCGCCTGGCTCCTAC
CCCCACCCTCCGCCCCCTGGCTTGCCTCCGTATGGCGGCCCAGCCCATCATGGCTTACCTGCTCCGTCTTCAAGC
GGCAATGTCGACTTGAGCGCTCTTCGCCCTGTAAACTCGGGAACCCTTAATTTTGAAGACATCATGTCCCAAGCA
CGAGCCTACGCGGCCGGAAAAGGAGCTACTTCATACGATCGCCCACCCACTTACAATGCCGATCCCCGAAGCGCG
GAGCGACCATACCGAACCTCGAGATCCCGCTCCCCACGGGCCGACTACCACAGAGACGAGCGCCGTGGTGGTCAC
GGTCGCGATCACGGCCGCGATAGATCTTATTCTCCTCCACCCCGCGGTCGTCCCTTTTCGCCTCGCGGAGGCAGT
GCTCGGGACAGATCACCTTTGCGAGGCGCCGACGATAATTCGGAGACTATTCAAATCGAGGCCAGCCTTGTGGGC
TTAATTATTGGTCGCCAAGGCGAGAATCTTCGACGCATTGAATCCGAGTCCAACTGTAGGGTGCAGTTTCTTGCT
GCCACGGATGGAGGTCCTTTTAGACAATGCAGAATATCTGGACCGCGGCAGCGTCGTGCCGAGGTCAAGGCAGCC
ATTGATCGTATCATAGAGGATAGTGGCATGGGTCCCCTGAACCGAGTGCCCGACAAGTCACGAGACACCAATAGA
GCGGGCACAGCCGGCCTCCGAGACGGCGAAGATCACATTCAAATCATGGTGCCAGATCGCACTGTTGGACTAATT
ATTGGTCGCGGAGGTGAGACTATTCGTGACCTCCAAGAACGCTCGGGATGTCACATAAACATTGTTGGAGAGTCC
AAAAGTGTCAATGGCCTCCGACCGGTAAATCTAATAGGCACCGTCGAAGCTACGTCTCGTGCCAAGGACTTCATC
ATGGAGATTGTCGATAGTGATACAAGAGGAGACGGTCCTGCTGGGAAGAAGGCGGCCGCCACGGCCCCCGTTGGC
GGTGGAATAAGCGGGCATGTCGACATACCTAATTCCTTGAGGGAAGCAGGCGGAAACGACAAGATTAATGATGCC
ATATATGTTCCTTCAGATGCTGTTGGAATGATTATAGGAAGAGGCGGCGAAACAATTCGTGAGATGCAAAACGCC
ACAGGGTGCAAAATCAACGTGGCCCAGTCTTCAGGTCCGGGAGAAGTGCAGAGAGAGATTGCTCTTATTGGTGCA
CGCGATAGCATAGCTCGCGCCAAAATGGCCATTGAGGAAAAGGTTGAAGCAGTGCGCCAGAAGAGCGGTGGCGGC
GGTGGCGGCGGCGGCGCTGGTGGCGGTCGTGGCCGGGGCTACCAGGACTTGGAACGAGGTCCTGGAGGTTCCTAT
GCGCAACAAGGCGCAAATGCGTCTACTACAGCTAACCAGACGCCTCAGGCGTCGACAGGTGATGGTCCTGATCCG
TATGCACAATACGGCGGATACCAGAACTATCTTGCTCTCTGGTATCAGTCATTAATGTACCAGCAACAACAACAG
CAACAGCAAGGCGGACAAGGCGCACCCGCCCCTGGAGCCTAG
Gene >OphauB2|2543
ATGGCAGAACCTCAACCAGATATCCAATCCATTCTTGCTGCACTGGGTGAGCACTTCACGGCCTGCTTATTGACG
CTTAGCATGAGTTGACCCCACTCCATATCCAGCATCCCAGCGTGGCCCGACGCAGACGCCAAGCCAGCAGCCTCC
CGGCGCATCGGCACCTGCATACCCTGCTCCATCTGCTTCGGCGCCACCGCCTGGCTCCTACCCCCACCCTCCGCC
CCCTGGCTTGCCTCCGTATGGCGGCCCAGCCCATCATGGCTTACCTGCTCCGTCTTCAAGCGGCAATGTCGACTT
GAGCGCTCTTCGCCCTGTAAACTCGGGAACCCTTAATTTTGAAGACATCATGTCCCAAGCACGAGCCTACGCGGC
CGGAAAAGGAGCTACTTCATACGATCGCCCACCCACTTACAATGCCGATCCCCGAAGCGCGGAGCGACCATACCG
AACCTCGAGATCCCGCTCCCCACGGGCCGACTACCACAGAGACGAGCGCCGTGGTGGTCACGGTCGCGATCACGG
CCGCGATAGATCTTATTCTCCTCCACCCCGCGGTCGTCCCTTTTCGCCTCGCGGAGGCAGTGCTCGGGACAGATC
ACCTTTGCGAGGCGCCGACGATAATTCGGAGACTATTCAAATCGAGGCCAGCCTTGTGGGCTTAATTATTGGTCG
CCAAGGCGAGAATCTTCGACGCATTGAATCCGAGTCCAACTGTAGGGTGCAGTTTCTTGCTGCCACGGATGGAGG
TCCTTTTAGACAATGCAGAATATCTGGACCGCGGCAGCGTCGTGCCGAGGTCAAGGCAGCCATTGATCGTATCAT
AGAGGATAGTGGCATGGGTCCCCTGAACCGAGTGCCCGACAAGTCACGAGACACCAATAGAGCGGGCACAGCCGG
CCTCCGAGACGGCGAAGATCACATTCAAATCATGGTGCCAGATCGCACTGTTGGACTAATTATTGGTCGCGGAGG
TGAGACTATTCGTGACCTCCAAGAACGCTCGGGATGTCACATAAACATTGTTGGAGAGTCCAAAAGTGTCAATGG
CCTCCGACCGGTAAATCTAATAGGCACCGTCGAAGCTACGTCTCGTGCCAAGGACTTCATCATGGAGATTGTCGA
TAGTGATACAAGAGGAGACGGTCCTGCTGGGAAGAAGGCGGCCGCCACGGCCCCCGTTGGCGGTGGAATAAGCGG
GCATGTCGACATACCTAATTCCTTGAGGGAAGCAGGCGGAAACGACAAGATTAATGATGCCATATATGTTCCTTC
AGATGCTGTTGGAATGATTATAGGAAGAGGCGGCGAAACAATTCGTGAGATGCAAAACGCCACAGGGTGCAAAAT
CAACGTGGCCCAGTCTTCAGGTCCGGGAGAAGTGCAGAGAGAGATTGCTCTTATTGGTGCACGCGATAGCATAGC
TCGCGCCAAAATGGCCATTGAGGAAAAGGTTGAAGCAGTGGTATGTCGAGTTGTCATGGCATTTACGCGAGGGTC
TTGTCTGTATAGTTTCTTGACTGACAAATCTGCAGCGCCAGAAGAGCGGTGGCGGCGGTGGCGGCGGCGGCGCTG
GTGGCGGTCGTGGCCGGGGCTACCAGGACTTGGAACGAGGTCCTGGAGGTTCCTATGCGCAACAAGGCGCAAATG
CGTCTACTACAGCTAACCAGACGCCTCAGGCGTCGACAGGTGATGGTCCTGATCCGTATGCACAATGTGAGTGAC
GGCCATGACACGGGGTGCCCCAAAATAGCAAGCTGACATGAAACGGCAGACGGCGGATACCAGAACTATCTTGCT
CTCTGGTATCAGTCATTAATGTACCAGCAACAACAACAGCAACAGCAAGGCGGACAAGGCGCACCCGCCCCTGGA
GCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail