Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2540
Gene name
LocationContig_18:216313..217781
Strand-
Gene length (bp)1468
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.0E-26 148 426

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 102 426 7.0E-50
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 149 424 7.0E-17
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 145 424 3.0E-12
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 149 420 6.0E-11
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 149 426 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 102 426 7.0E-50
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 149 424 7.0E-17
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 145 424 3.0E-12
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 149 420 6.0E-11
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 149 426 1.0E-10
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 146 426 2.0E-10
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 149 426 2.0E-10
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 148 424 9.0E-10
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 146 426 1.0E-09
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 151 418 3.0E-09
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 151 418 4.0E-09
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 148 424 5.0E-09
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 151 426 5.0E-09
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 151 420 9.0E-09
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 151 418 1.0E-08
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 151 426 2.0E-08
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 124 426 6.0E-08
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 124 426 8.0E-08
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 149 420 1.0E-07
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 144 426 1.0E-07
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 125 426 4.0E-07
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 151 426 6.0E-07
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 149 424 1.0E-06
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 151 429 1.0E-06
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 151 429 1.0E-06
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 251 430 2.0E-06
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 151 418 3.0E-06
sp|A1CBR4|PEPA_ASPCL Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 151 429 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999524

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4901
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3971
Ophiocordyceps australis map64 (Brazil) OphauB2|2540 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04314
Ophiocordyceps camponoti-rufipedis Ophun1|4958
Ophiocordyceps kimflemingae Ophio5|1155
Ophiocordyceps subramaniannii Hirsu2|1353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2540
MRAFSLVPCAVAWSLSLLLAARADSGWDISKPLNGITFERAKAVQSGPTPDGPAPRFSRLRNIKGRPSTHSAVSA
LGRVLRGQGGVGHEPVWQNISKAGDFTTHSDTWAVQKGFRCDDGYGTENSEAACGFGKPLIDKFGKGSIEDLHFF
LKYGSGERVVGPMGRSEISCGGVTVPEQQVGLANYTYWHGNNMTVGVLGLAYQSLTSAFYGDVGTEAPWNAMSYS
PFLTNAITQGSMDPVFSVALVKNSSEGILAWGGLPPMAMAPRSRSVSAATDLIIANLVGQAEASWRYSFYTIVPD
GIQWGQTKDSTKYPYIVDTGTTMNYLPPPLAEAVAMAFEPRAVYMYQWGSYFAPCDAIPPRFAVIISGVEFWINP
ADLLYQDLRDPLTGYCAVAISSGGSGPYILGDVFLQNVVAVFDVGGAQMRFYSRH*
Coding >OphauB2|2540
ATGAGAGCATTCAGCTTGGTACCATGTGCCGTAGCGTGGTCTCTGAGTCTGCTTTTGGCGGCCAGGGCGGACTCT
GGCTGGGACATTTCCAAACCACTCAACGGCATCACCTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GACGGACCAGCGCCGCGCTTTTCCCGCCTTCGCAACATCAAGGGACGCCCCAGCACGCACAGTGCCGTGTCAGCG
CTGGGAAGAGTTTTGCGTGGGCAGGGCGGAGTAGGCCATGAGCCCGTGTGGCAAAACATTAGCAAGGCGGGCGAC
TTTACGACGCACTCAGACACTTGGGCGGTGCAAAAGGGCTTTCGATGCGACGATGGCTACGGGACCGAGAACAGC
GAGGCGGCATGCGGGTTTGGCAAGCCGCTGATTGACAAGTTTGGCAAGGGCAGCATTGAAGACTTGCACTTTTTC
CTCAAGTATGGGTCAGGCGAGCGCGTCGTGGGGCCCATGGGCCGGAGCGAGATATCGTGCGGCGGCGTCACGGTG
CCGGAGCAGCAGGTGGGCCTGGCCAACTACACGTACTGGCACGGCAACAACATGACGGTGGGCGTGCTGGGGCTG
GCCTACCAGTCGCTGACGAGCGCCTTTTACGGCGATGTCGGGACCGAGGCGCCATGGAACGCCATGTCGTACTCG
CCCTTTTTGACCAATGCCATTACGCAGGGCTCCATGGATCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCC
GAGGGGATTCTGGCGTGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGTAGCGTGTCTGCAGCAACG
GACCTGATTATTGCCAATCTGGTGGGACAGGCAGAGGCGTCGTGGAGGTATTCGTTTTACACCATTGTGCCCGAC
GGGATCCAGTGGGGCCAGACCAAGGACAGCACCAAGTACCCCTACATTGTCGACACGGGCACCACGATGAATTAC
CTGCCGCCTCCACTGGCCGAGGCTGTGGCAATGGCGTTTGAGCCACGGGCCGTCTACATGTACCAATGGGGCTCC
TACTTTGCGCCGTGTGATGCCATTCCACCACGCTTCGCCGTCATCATCTCGGGCGTCGAGTTTTGGATCAATCCT
GCCGATCTCTTGTACCAGGATCTGCGGGATCCGCTAACGGGCTACTGTGCCGTGGCCATATCGAGCGGAGGCTCG
GGCCCGTATATACTGGGCGATGTCTTTTTGCAAAACGTCGTGGCAGTGTTTGATGTGGGCGGTGCACAAATGCGC
TTCTACTCGCGACACTAA
Transcript >OphauB2|2540
ATGAGAGCATTCAGCTTGGTACCATGTGCCGTAGCGTGGTCTCTGAGTCTGCTTTTGGCGGCCAGGGCGGACTCT
GGCTGGGACATTTCCAAACCACTCAACGGCATCACCTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GACGGACCAGCGCCGCGCTTTTCCCGCCTTCGCAACATCAAGGGACGCCCCAGCACGCACAGTGCCGTGTCAGCG
CTGGGAAGAGTTTTGCGTGGGCAGGGCGGAGTAGGCCATGAGCCCGTGTGGCAAAACATTAGCAAGGCGGGCGAC
TTTACGACGCACTCAGACACTTGGGCGGTGCAAAAGGGCTTTCGATGCGACGATGGCTACGGGACCGAGAACAGC
GAGGCGGCATGCGGGTTTGGCAAGCCGCTGATTGACAAGTTTGGCAAGGGCAGCATTGAAGACTTGCACTTTTTC
CTCAAGTATGGGTCAGGCGAGCGCGTCGTGGGGCCCATGGGCCGGAGCGAGATATCGTGCGGCGGCGTCACGGTG
CCGGAGCAGCAGGTGGGCCTGGCCAACTACACGTACTGGCACGGCAACAACATGACGGTGGGCGTGCTGGGGCTG
GCCTACCAGTCGCTGACGAGCGCCTTTTACGGCGATGTCGGGACCGAGGCGCCATGGAACGCCATGTCGTACTCG
CCCTTTTTGACCAATGCCATTACGCAGGGCTCCATGGATCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCC
GAGGGGATTCTGGCGTGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGTAGCGTGTCTGCAGCAACG
GACCTGATTATTGCCAATCTGGTGGGACAGGCAGAGGCGTCGTGGAGGTATTCGTTTTACACCATTGTGCCCGAC
GGGATCCAGTGGGGCCAGACCAAGGACAGCACCAAGTACCCCTACATTGTCGACACGGGCACCACGATGAATTAC
CTGCCGCCTCCACTGGCCGAGGCTGTGGCAATGGCGTTTGAGCCACGGGCCGTCTACATGTACCAATGGGGCTCC
TACTTTGCGCCGTGTGATGCCATTCCACCACGCTTCGCCGTCATCATCTCGGGCGTCGAGTTTTGGATCAATCCT
GCCGATCTCTTGTACCAGGATCTGCGGGATCCGCTAACGGGCTACTGTGCCGTGGCCATATCGAGCGGAGGCTCG
GGCCCGTATATACTGGGCGATGTCTTTTTGCAAAACGTCGTGGCAGTGTTTGATGTGGGCGGTGCACAAATGCGC
TTCTACTCGCGACACTAA
Gene >OphauB2|2540
ATGAGAGCATTCAGCTTGGTACCATGTGCCGTAGCGTGGTCTCTGAGTCTGCTTTTGGCGGCCAGGGCGGACTCT
GGCTGGGACATTTCCAAACCACTCAACGGCATCACCTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GACGGACCAGCGCCGCGCTTTTCCCGCCTTCGCAACATCAAGGGACGCCCCAGCACGCACAGTGCCGTGTCAGCG
CTGGGAAGAGTTTTGCGTGGGCAGGGCGGAGTAGGCCATGAGCCCGTGTGGCAAAACATTAGCAAGGCGGGCGAC
TTTACGACGCAGTATGCCATTGAGTGCGGATGGGACGGGGTGCCAGTGTGGCTCCTTTTTGACACGGGCAGCTCA
GACACTTGGGCGGTGCAAAAGGGCTTTCGATGCGACGATGGCTACGGGACCGAGAACAGCGAGGCGGCATGCGGG
TTTGGCAAGCCGCTGATTGACAAGTTTGGCAAGGGCAGCATTGAAGACTTGCACTTTTTCCTCAAGTATGGGTCA
GGCGAGCGCGTCGTGGGGCCCATGGGCCGGAGCGAGATATCGTGCGGCGGCGTCACGGTGCCGGAGCAGCAGGTG
GGCCTGGCCAACTACACGTACTGGCACGGCAACAACATGACGGTGGGCGTGCTGGGGCTGGCCTACCAGTCGCTG
ACGAGCGCCTTTTACGGCGATGTCGGGACCGAGGCGCCATGGAACGCCATGTCGTACTCGCCCTTTTTGACCAAT
GCCATTACGCAGGGCTCCATGGATCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCCGAGGGGATTCTGGCG
TGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGTAGCGTGTCTGCAGCAACGGACCTGATTATTGTG
AGTTTTTTTGCAAAAGAGCTGTGGCGTGGTGTTGGCTGACTGGGAGGGGGTGGGCAGGCCAATCTGGTGGGACAG
GCAGAGGCGTCGTGGAGGTATTCGTTTTACACCATTGTGCCCGACGGGATCCAGTGGGGCCAGACCAAGGACAGC
ACCAAGTACCCCTACATTGTCGACACGGGCACCACGATGAATTACCTGCCGCCTCGTAAGTCGATGGATATAAAT
GGCCAAGGTGGCACGAGCTGGCTGACGAGACACAGCACTGGCCGAGGCTGTGGCAATGGCGTTTGAGCCACGGGC
CGTCTACATGTACCAATGGGGCTCCTACTTTGCGCCGTGTGATGCCATTCCACCACGCTTCGCCGTCATCATCTC
GGGCGTCGAGTTTTGGATCAATCCTGCCGATCTCTTGTACCAGGATCTGCGGGATCCGCTAACGGGCTACTGTGC
CGTGGCCATATCGAGCGGAGGCTCGGGCCCGTATATACTGGGCGATGTCTTTTTGCAAAACGTCGTGGCAGTGTT
TGATGTGGGCGGTGCACAAATGCGCTTCTACTCGCGACACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail