Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2540
Gene name
LocationContig_18:216313..217781
Strand-
Gene length (bp)1468
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.0E-26 148 426

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 102 426 7.0E-50
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 149 424 7.0E-17
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 145 424 3.0E-12
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 149 420 6.0E-11
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 149 426 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 102 426 7.0E-50
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 149 424 7.0E-17
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 145 424 3.0E-12
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 149 420 6.0E-11
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 149 426 1.0E-10
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 146 426 2.0E-10
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 149 426 2.0E-10
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 148 424 9.0E-10
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 146 426 1.0E-09
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 151 418 3.0E-09
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 151 418 4.0E-09
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 148 424 5.0E-09
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 151 426 5.0E-09
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 151 420 9.0E-09
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 151 418 1.0E-08
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 151 426 2.0E-08
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 124 426 6.0E-08
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 124 426 8.0E-08
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 149 420 1.0E-07
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 144 426 1.0E-07
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 125 426 4.0E-07
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 151 426 6.0E-07
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 149 424 1.0E-06
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 151 429 1.0E-06
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 151 429 1.0E-06
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 251 430 2.0E-06
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 151 418 3.0E-06
sp|A1CBR4|PEPA_ASPCL Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 151 429 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2540
MRAFSLVPCAVAWSLSLLLAARADSGWDISKPLNGITFERAKAVQSGPTPDGPAPRFSRLRNIKGRPSTHSAVSA
LGRVLRGQGGVGHEPVWQNISKAGDFTTHSDTWAVQKGFRCDDGYGTENSEAACGFGKPLIDKFGKGSIEDLHFF
LKYGSGERVVGPMGRSEISCGGVTVPEQQVGLANYTYWHGNNMTVGVLGLAYQSLTSAFYGDVGTEAPWNAMSYS
PFLTNAITQGSMDPVFSVALVKNSSEGILAWGGLPPMAMAPRSRSVSAATDLIIANLVGQAEASWRYSFYTIVPD
GIQWGQTKDSTKYPYIVDTGTTMNYLPPPLAEAVAMAFEPRAVYMYQWGSYFAPCDAIPPRFAVIISGVEFWINP
ADLLYQDLRDPLTGYCAVAISSGGSGPYILGDVFLQNVVAVFDVGGAQMRFYSRH*
Coding >OphauB2|2540
ATGAGAGCATTCAGCTTGGTACCATGTGCCGTAGCGTGGTCTCTGAGTCTGCTTTTGGCGGCCAGGGCGGACTCT
GGCTGGGACATTTCCAAACCACTCAACGGCATCACCTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GACGGACCAGCGCCGCGCTTTTCCCGCCTTCGCAACATCAAGGGACGCCCCAGCACGCACAGTGCCGTGTCAGCG
CTGGGAAGAGTTTTGCGTGGGCAGGGCGGAGTAGGCCATGAGCCCGTGTGGCAAAACATTAGCAAGGCGGGCGAC
TTTACGACGCACTCAGACACTTGGGCGGTGCAAAAGGGCTTTCGATGCGACGATGGCTACGGGACCGAGAACAGC
GAGGCGGCATGCGGGTTTGGCAAGCCGCTGATTGACAAGTTTGGCAAGGGCAGCATTGAAGACTTGCACTTTTTC
CTCAAGTATGGGTCAGGCGAGCGCGTCGTGGGGCCCATGGGCCGGAGCGAGATATCGTGCGGCGGCGTCACGGTG
CCGGAGCAGCAGGTGGGCCTGGCCAACTACACGTACTGGCACGGCAACAACATGACGGTGGGCGTGCTGGGGCTG
GCCTACCAGTCGCTGACGAGCGCCTTTTACGGCGATGTCGGGACCGAGGCGCCATGGAACGCCATGTCGTACTCG
CCCTTTTTGACCAATGCCATTACGCAGGGCTCCATGGATCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCC
GAGGGGATTCTGGCGTGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGTAGCGTGTCTGCAGCAACG
GACCTGATTATTGCCAATCTGGTGGGACAGGCAGAGGCGTCGTGGAGGTATTCGTTTTACACCATTGTGCCCGAC
GGGATCCAGTGGGGCCAGACCAAGGACAGCACCAAGTACCCCTACATTGTCGACACGGGCACCACGATGAATTAC
CTGCCGCCTCCACTGGCCGAGGCTGTGGCAATGGCGTTTGAGCCACGGGCCGTCTACATGTACCAATGGGGCTCC
TACTTTGCGCCGTGTGATGCCATTCCACCACGCTTCGCCGTCATCATCTCGGGCGTCGAGTTTTGGATCAATCCT
GCCGATCTCTTGTACCAGGATCTGCGGGATCCGCTAACGGGCTACTGTGCCGTGGCCATATCGAGCGGAGGCTCG
GGCCCGTATATACTGGGCGATGTCTTTTTGCAAAACGTCGTGGCAGTGTTTGATGTGGGCGGTGCACAAATGCGC
TTCTACTCGCGACACTAA
Transcript >OphauB2|2540
ATGAGAGCATTCAGCTTGGTACCATGTGCCGTAGCGTGGTCTCTGAGTCTGCTTTTGGCGGCCAGGGCGGACTCT
GGCTGGGACATTTCCAAACCACTCAACGGCATCACCTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GACGGACCAGCGCCGCGCTTTTCCCGCCTTCGCAACATCAAGGGACGCCCCAGCACGCACAGTGCCGTGTCAGCG
CTGGGAAGAGTTTTGCGTGGGCAGGGCGGAGTAGGCCATGAGCCCGTGTGGCAAAACATTAGCAAGGCGGGCGAC
TTTACGACGCACTCAGACACTTGGGCGGTGCAAAAGGGCTTTCGATGCGACGATGGCTACGGGACCGAGAACAGC
GAGGCGGCATGCGGGTTTGGCAAGCCGCTGATTGACAAGTTTGGCAAGGGCAGCATTGAAGACTTGCACTTTTTC
CTCAAGTATGGGTCAGGCGAGCGCGTCGTGGGGCCCATGGGCCGGAGCGAGATATCGTGCGGCGGCGTCACGGTG
CCGGAGCAGCAGGTGGGCCTGGCCAACTACACGTACTGGCACGGCAACAACATGACGGTGGGCGTGCTGGGGCTG
GCCTACCAGTCGCTGACGAGCGCCTTTTACGGCGATGTCGGGACCGAGGCGCCATGGAACGCCATGTCGTACTCG
CCCTTTTTGACCAATGCCATTACGCAGGGCTCCATGGATCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCC
GAGGGGATTCTGGCGTGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGTAGCGTGTCTGCAGCAACG
GACCTGATTATTGCCAATCTGGTGGGACAGGCAGAGGCGTCGTGGAGGTATTCGTTTTACACCATTGTGCCCGAC
GGGATCCAGTGGGGCCAGACCAAGGACAGCACCAAGTACCCCTACATTGTCGACACGGGCACCACGATGAATTAC
CTGCCGCCTCCACTGGCCGAGGCTGTGGCAATGGCGTTTGAGCCACGGGCCGTCTACATGTACCAATGGGGCTCC
TACTTTGCGCCGTGTGATGCCATTCCACCACGCTTCGCCGTCATCATCTCGGGCGTCGAGTTTTGGATCAATCCT
GCCGATCTCTTGTACCAGGATCTGCGGGATCCGCTAACGGGCTACTGTGCCGTGGCCATATCGAGCGGAGGCTCG
GGCCCGTATATACTGGGCGATGTCTTTTTGCAAAACGTCGTGGCAGTGTTTGATGTGGGCGGTGCACAAATGCGC
TTCTACTCGCGACACTAA
Gene >OphauB2|2540
ATGAGAGCATTCAGCTTGGTACCATGTGCCGTAGCGTGGTCTCTGAGTCTGCTTTTGGCGGCCAGGGCGGACTCT
GGCTGGGACATTTCCAAACCACTCAACGGCATCACCTTTGAGCGGGCCAAGGCAGTACAAAGCGGCCCAACGCCA
GACGGACCAGCGCCGCGCTTTTCCCGCCTTCGCAACATCAAGGGACGCCCCAGCACGCACAGTGCCGTGTCAGCG
CTGGGAAGAGTTTTGCGTGGGCAGGGCGGAGTAGGCCATGAGCCCGTGTGGCAAAACATTAGCAAGGCGGGCGAC
TTTACGACGCAGTATGCCATTGAGTGCGGATGGGACGGGGTGCCAGTGTGGCTCCTTTTTGACACGGGCAGCTCA
GACACTTGGGCGGTGCAAAAGGGCTTTCGATGCGACGATGGCTACGGGACCGAGAACAGCGAGGCGGCATGCGGG
TTTGGCAAGCCGCTGATTGACAAGTTTGGCAAGGGCAGCATTGAAGACTTGCACTTTTTCCTCAAGTATGGGTCA
GGCGAGCGCGTCGTGGGGCCCATGGGCCGGAGCGAGATATCGTGCGGCGGCGTCACGGTGCCGGAGCAGCAGGTG
GGCCTGGCCAACTACACGTACTGGCACGGCAACAACATGACGGTGGGCGTGCTGGGGCTGGCCTACCAGTCGCTG
ACGAGCGCCTTTTACGGCGATGTCGGGACCGAGGCGCCATGGAACGCCATGTCGTACTCGCCCTTTTTGACCAAT
GCCATTACGCAGGGCTCCATGGATCCAGTCTTTAGCGTGGCGCTCGTCAAGAACTCTTCCGAGGGGATTCTGGCG
TGGGGCGGACTGCCGCCCATGGCCATGGCTCCGCGCAGCCGTAGCGTGTCTGCAGCAACGGACCTGATTATTGTG
AGTTTTTTTGCAAAAGAGCTGTGGCGTGGTGTTGGCTGACTGGGAGGGGGTGGGCAGGCCAATCTGGTGGGACAG
GCAGAGGCGTCGTGGAGGTATTCGTTTTACACCATTGTGCCCGACGGGATCCAGTGGGGCCAGACCAAGGACAGC
ACCAAGTACCCCTACATTGTCGACACGGGCACCACGATGAATTACCTGCCGCCTCGTAAGTCGATGGATATAAAT
GGCCAAGGTGGCACGAGCTGGCTGACGAGACACAGCACTGGCCGAGGCTGTGGCAATGGCGTTTGAGCCACGGGC
CGTCTACATGTACCAATGGGGCTCCTACTTTGCGCCGTGTGATGCCATTCCACCACGCTTCGCCGTCATCATCTC
GGGCGTCGAGTTTTGGATCAATCCTGCCGATCTCTTGTACCAGGATCTGCGGGATCCGCTAACGGGCTACTGTGC
CGTGGCCATATCGAGCGGAGGCTCGGGCCCGTATATACTGGGCGATGTCTTTTTGCAAAACGTCGTGGCAGTGTT
TGATGTGGGCGGTGCACAAATGCGCTTCTACTCGCGACACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail