Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|254
Gene name
LocationContig_10:257505..258657
Strand-
Gene length (bp)1152
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7SIC2|QDOI_ASPJA Quercetin 2,3-dioxygenase OS=Aspergillus japonicus PE=1 SV=1 29 381 3.0E-75
sp|P42106|QDOI_BACSU Quercetin 2,3-dioxygenase OS=Bacillus subtilis (strain 168) GN=qdoI PE=1 SV=2 19 165 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|254
MKASSLFTLALSASLSTASCAAAAEEAGSQEILVNEAPDFVRPYVLPKYRGRAIKLTPTQIIRFSITTNSSGGAF
SLIQHNGQQSSWLSARPHTHRLTHEHFYCARGRVQLWGMKNATNSSEEARVGTVGDYGNVPPGAIHTFQLTDPDA
QLTHVFHPGGFEHLFDIFSTGEHDTAGISSPYVALAVDPDPFGPFTPEQDTLLQGLDLYAAPEEDYKPRRDFVNG
TAGGPGHKWHDGPNTLPNDPTEPYFVAKDYGPKFLNSEAGFKIIQPLATPKQSAEGNFTMGTIVMSPKLESTAVS
SATLPHHFALQMDDGQLSLTIEGYKTVLMMHGDVAFIPAGTPFEYHATVPYTKFLYMNAGAEGLDAQLLKDSKEW
EWPAYPDA*
Coding >OphauB2|254
ATGAAAGCCTCAAGTCTCTTCACACTGGCCCTTTCCGCCAGCCTATCCACAGCATCCTGTGCAGCTGCTGCTGAG
GAAGCCGGCAGCCAAGAGATTCTCGTCAACGAGGCCCCCGACTTTGTGCGGCCCTACGTGCTGCCCAAATACCGA
GGCCGCGCCATCAAGCTCACGCCCACGCAAATCATTCGCTTCTCCATCACTACAAACTCGTCTGGCGGTGCCTTT
TCCCTTATTCAGCACAATGGGCAGCAGTCTTCATGGCTCTCTGCCCGTCCACACACCCATCGTCTCACGCACGAG
CACTTTTACTGCGCGCGAGGCCGCGTCCAGCTCTGGGGCATGAAGAATGCGACAAACTCGAGCGAGGAGGCCCGG
GTGGGCACCGTGGGCGACTATGGCAATGTTCCCCCTGGCGCAATCCATACCTTTCAGCTCACCGACCCCGACGCC
CAGCTGACGCACGTCTTTCATCCTGGAGGCTTTGAGCACTTGTTTGACATTTTTAGCACCGGCGAGCACGACACG
GCGGGCATCAGCTCTCCCTATGTTGCCCTTGCGGTGGACCCCGACCCCTTTGGCCCCTTTACGCCGGAGCAGGAC
ACGCTCCTCCAGGGCTTGGATCTTTATGCCGCGCCGGAAGAGGACTATAAGCCGCGCCGAGACTTTGTCAATGGC
ACGGCTGGCGGGCCAGGACACAAGTGGCACGACGGGCCCAACACGCTGCCAAATGACCCGACGGAGCCATATTTT
GTCGCCAAGGACTATGGGCCAAAGTTTCTCAATTCCGAGGCTGGATTCAAGATTATCCAGCCGCTTGCTACCCCG
AAGCAATCCGCAGAGGGCAACTTTACCATGGGCACCATTGTCATGTCTCCCAAGCTGGAGAGCACGGCGGTGTCC
AGTGCTACTCTGCCGCATCACTTTGCCTTGCAAATGGACGATGGCCAGCTCTCGCTTACCATTGAAGGATACAAG
ACGGTCTTGATGATGCATGGCGACGTGGCTTTTATACCGGCTGGAACGCCGTTTGAGTACCACGCCACGGTTCCC
TATACAAAGTTTCTGTATATGAATGCTGGTGCAGAGGGACTCGACGCACAGTTGCTCAAGGACAGCAAGGAATGG
GAGTGGCCTGCGTACCCTGATGCGTAG
Transcript >OphauB2|254
ATGAAAGCCTCAAGTCTCTTCACACTGGCCCTTTCCGCCAGCCTATCCACAGCATCCTGTGCAGCTGCTGCTGAG
GAAGCCGGCAGCCAAGAGATTCTCGTCAACGAGGCCCCCGACTTTGTGCGGCCCTACGTGCTGCCCAAATACCGA
GGCCGCGCCATCAAGCTCACGCCCACGCAAATCATTCGCTTCTCCATCACTACAAACTCGTCTGGCGGTGCCTTT
TCCCTTATTCAGCACAATGGGCAGCAGTCTTCATGGCTCTCTGCCCGTCCACACACCCATCGTCTCACGCACGAG
CACTTTTACTGCGCGCGAGGCCGCGTCCAGCTCTGGGGCATGAAGAATGCGACAAACTCGAGCGAGGAGGCCCGG
GTGGGCACCGTGGGCGACTATGGCAATGTTCCCCCTGGCGCAATCCATACCTTTCAGCTCACCGACCCCGACGCC
CAGCTGACGCACGTCTTTCATCCTGGAGGCTTTGAGCACTTGTTTGACATTTTTAGCACCGGCGAGCACGACACG
GCGGGCATCAGCTCTCCCTATGTTGCCCTTGCGGTGGACCCCGACCCCTTTGGCCCCTTTACGCCGGAGCAGGAC
ACGCTCCTCCAGGGCTTGGATCTTTATGCCGCGCCGGAAGAGGACTATAAGCCGCGCCGAGACTTTGTCAATGGC
ACGGCTGGCGGGCCAGGACACAAGTGGCACGACGGGCCCAACACGCTGCCAAATGACCCGACGGAGCCATATTTT
GTCGCCAAGGACTATGGGCCAAAGTTTCTCAATTCCGAGGCTGGATTCAAGATTATCCAGCCGCTTGCTACCCCG
AAGCAATCCGCAGAGGGCAACTTTACCATGGGCACCATTGTCATGTCTCCCAAGCTGGAGAGCACGGCGGTGTCC
AGTGCTACTCTGCCGCATCACTTTGCCTTGCAAATGGACGATGGCCAGCTCTCGCTTACCATTGAAGGATACAAG
ACGGTCTTGATGATGCATGGCGACGTGGCTTTTATACCGGCTGGAACGCCGTTTGAGTACCACGCCACGGTTCCC
TATACAAAGTTTCTGTATATGAATGCTGGTGCAGAGGGACTCGACGCACAGTTGCTCAAGGACAGCAAGGAATGG
GAGTGGCCTGCGTACCCTGATGCGTAG
Gene >OphauB2|254
ATGAAAGCCTCAAGTCTCTTCACACTGGCCCTTTCCGCCAGCCTATCCACAGCATCCTGTGCAGCTGCTGCTGAG
GAAGCCGGCAGCCAAGAGATTCTCGTCAACGAGGCCCCCGACTTTGTGCGGCCCTACGTGCTGCCCAAATACCGA
GGCCGCGCCATCAAGCTCACGCCCACGCAAATCATTCGCTTCTCCATCACTACAAACTCGTCTGGCGGTGCCTTT
TCCCTTATTCAGCACAATGGGCAGCAGTCTTCATGGCTCTCTGCCCGTCCACACACCCATCGTCTCACGCACGAG
CACTTTTACTGCGCGCGAGGCCGCGTCCAGCTCTGGGGCATGAAGAATGCGACAAACTCGAGCGAGGAGGCCCGG
GTGGGCACCGTGGGCGACTATGGCAATGTTCCCCCTGGCGCAATCCATACCTTTCAGCTCACCGACCCCGACGCC
CAGCTGACGCACGTCTTTCATCCTGGAGGCTTTGAGCACTTGTTTGACATTTTTAGCACCGGCGAGCACGACACG
GCGGGCATCAGCTCTCCCTATGTTGCCCTTGCGGTGGACCCCGACCCCTTTGGCCCCTTTACGCCGGAGCAGGAC
ACGCTCCTCCAGGGCTTGGATCTTTATGCCGCGCCGGAAGAGGACTATAAGCCGCGCCGAGACTTTGTCAATGGC
ACGGCTGGCGGGCCAGGACACAAGTGGCACGACGGGCCCAACACGCTGCCAAATGACCCGACGGAGCCATATTTT
GTCGCCAAGGACTATGGGCCAAAGTTTCTCAATTCCGAGGCTGGATTCAAGATTATCCAGCCGCTTGCTACCCCG
AAGCAATCCGCAGAGGGCAACTTTACCATGGGCACCATTGTCATGTCTCCCAAGCTGGAGAGCACGGCGGTGTCC
AGTGCTACTCTGCCGCATCACTTTGCCTTGCAAATGGACGATGGCCAGCTCTCGCTTACCATTGAAGGATACAAG
ACGGTCTTGATGATGCATGGCGACGTGGCTTTTATACCGGCTGGAACGCCGTTTGAGTACCACGCCACGGTTCCC
TATACAAAGTTTCTGTATATGAATGCTGGTGCAGAGGGACTCGACGCACAGTTGCTCAAGGACAGCAAGGAATGG
GAGTGGCCTGCGTACCCTGATGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail