Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2539
Gene name
LocationContig_18:213509..215050
Strand-
Gene length (bp)1541
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 6.4E-79 13 228
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 6.2E-34 231 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 17 434 5.0E-178
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 12 445 8.0E-143
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 10 436 8.0E-143
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 12 445 1.0E-142
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 12 445 3.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 17 434 5.0E-178
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 12 445 8.0E-143
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 10 436 8.0E-143
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 12 445 1.0E-142
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 12 445 3.0E-142
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 10 436 7.0E-142
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 10 436 8.0E-142
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 12 445 8.0E-142
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 22 444 1.0E-140
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 17 444 1.0E-140
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 17 440 2.0E-140
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 14 445 6.0E-140
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 14 431 1.0E-139
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 17 440 2.0E-139
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 22 440 6.0E-139
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 14 431 4.0E-138
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 2 431 1.0E-137
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 11 441 2.0E-137
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 14 431 9.0E-136
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 14 431 2.0E-135
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 22 422 5.0E-131
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 16 419 9.0E-118
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 20 431 7.0E-116
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 18 412 4.0E-94
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 19 418 6.0E-86
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 7 270 6.0E-62
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 19 426 4.0E-52
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 12 412 1.0E-39
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 275 418 2.0E-31
sp|D3DFG8|PSPA_HYDTT Phosphoserine phosphatase 1 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspA PE=1 SV=1 233 392 2.0E-13
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 233 381 8.0E-07
sp|P39701|COBC_SALTY Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobC PE=1 SV=3 231 392 3.0E-06
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 235 382 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0006000 fructose metabolic process Yes
GO:0005524 ATP binding Yes
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008443 phosphofructokinase activity No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0044238 primary metabolic process No
GO:0019318 hexose metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:0019200 carbohydrate kinase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2539
MALLKKSNNGVGVQVEDTKICVVMVGLPARGKSYIAQIAQRYLQWLSIPAQTFNVGSYRRNDAPQPTADFFDTNN
AEGERKRRAAAQAAVADMLAWFRSGGVVGILDATNSTKERRKWVLDACSAEGIEVLFVESKCDDEDIIMANIRDV
KTTSPDYKGQDPEAAAQDFRNRIRNYEKIYKTIDGDGDEDDYTYIKIMDVGKQVIINHIQDYLQSRIVYYLMNLH
IRPRSVWLSRHGESQYNLDGRIGGDTLLSPRGELYAKKLPELVRESVGDDRPLTVWTSTLKRTIATARFLPPHYN
QLQWKALDELDSGVCDGLTYQEIKDRYPEDFAARDEDKYNYRYRGGESYRDVVIRLEPIIMELERSEDILIVTHQ
AVLRCIYAYFMKKDQAKSPWMNVPLHTLIKLTPRAYGTEEVRYEANIPAVSTWRGKGSTAKHETPNAESL*
Coding >OphauB2|2539
ATGGCGTTGCTGAAGAAGTCTAACAATGGCGTGGGCGTGCAGGTCGAGGACACCAAGATATGTGTCGTCATGGTG
GGCTTGCCGGCCCGCGGCAAAAGCTACATTGCACAAATTGCACAGCGTTATCTGCAGTGGCTGTCGATTCCCGCC
CAGACTTTTAACGTGGGAAGCTATCGTCGCAACGACGCACCACAGCCCACGGCCGACTTTTTTGACACCAACAAT
GCCGAGGGCGAGCGCAAGCGCCGTGCTGCCGCCCAGGCTGCTGTTGCCGACATGCTGGCTTGGTTTCGCTCGGGC
GGCGTCGTGGGCATTCTGGATGCTACAAACTCGACCAAGGAACGCCGCAAATGGGTCCTGGACGCGTGCAGTGCC
GAGGGCATCGAGGTGCTCTTTGTCGAGAGCAAGTGCGACGACGAAGACATCATCATGGCAAATATTAGGGATGTG
AAGACGACGAGCCCCGACTACAAGGGCCAGGACCCAGAAGCGGCTGCCCAAGACTTTCGAAATCGCATCCGCAAT
TATGAAAAGATATACAAGACGATTGACGGCGACGGCGACGAGGACGATTATACCTATATCAAGATTATGGACGTT
GGGAAGCAAGTCATTATCAACCACATTCAAGACTACTTGCAGAGCCGCATCGTCTACTACCTGATGAATCTCCAC
ATTCGCCCTCGTTCTGTCTGGTTGTCAAGACATGGCGAGTCACAGTATAACCTGGATGGCAGAATTGGTGGAGAC
ACGCTCTTGTCGCCTCGCGGCGAGCTCTATGCCAAGAAGCTTCCGGAGCTGGTTCGCGAGTCTGTCGGGGACGAC
CGGCCCCTGACGGTGTGGACTTCAACGCTGAAGCGAACCATTGCCACGGCTCGATTTTTGCCTCCACATTACAAC
CAGCTGCAATGGAAGGCTCTGGATGAACTCGACTCGGGCGTATGTGACGGGCTGACATACCAAGAGATTAAGGAT
CGCTACCCCGAAGACTTTGCTGCTCGCGACGAGGACAAGTACAATTACCGCTACCGCGGTGGCGAGTCGTACCGC
GACGTGGTGATTCGCCTGGAGCCAATTATTATGGAGCTGGAACGCAGCGAGGACATCTTGATTGTTACTCACCAA
GCTGTGCTGCGGTGCATTTATGCCTACTTTATGAAGAAGGACCAGGCTAAGAGCCCGTGGATGAATGTGCCTCTG
CACACTCTGATTAAACTGACCCCGAGAGCCTATGGCACCGAAGAAGTGCGCTACGAGGCCAATATCCCCGCAGTC
AGCACTTGGCGCGGAAAGGGCAGCACGGCCAAGCACGAGACGCCCAATGCCGAAAGCCTCTGA
Transcript >OphauB2|2539
ATGGCGTTGCTGAAGAAGTCTAACAATGGCGTGGGCGTGCAGGTCGAGGACACCAAGATATGTGTCGTCATGGTG
GGCTTGCCGGCCCGCGGCAAAAGCTACATTGCACAAATTGCACAGCGTTATCTGCAGTGGCTGTCGATTCCCGCC
CAGACTTTTAACGTGGGAAGCTATCGTCGCAACGACGCACCACAGCCCACGGCCGACTTTTTTGACACCAACAAT
GCCGAGGGCGAGCGCAAGCGCCGTGCTGCCGCCCAGGCTGCTGTTGCCGACATGCTGGCTTGGTTTCGCTCGGGC
GGCGTCGTGGGCATTCTGGATGCTACAAACTCGACCAAGGAACGCCGCAAATGGGTCCTGGACGCGTGCAGTGCC
GAGGGCATCGAGGTGCTCTTTGTCGAGAGCAAGTGCGACGACGAAGACATCATCATGGCAAATATTAGGGATGTG
AAGACGACGAGCCCCGACTACAAGGGCCAGGACCCAGAAGCGGCTGCCCAAGACTTTCGAAATCGCATCCGCAAT
TATGAAAAGATATACAAGACGATTGACGGCGACGGCGACGAGGACGATTATACCTATATCAAGATTATGGACGTT
GGGAAGCAAGTCATTATCAACCACATTCAAGACTACTTGCAGAGCCGCATCGTCTACTACCTGATGAATCTCCAC
ATTCGCCCTCGTTCTGTCTGGTTGTCAAGACATGGCGAGTCACAGTATAACCTGGATGGCAGAATTGGTGGAGAC
ACGCTCTTGTCGCCTCGCGGCGAGCTCTATGCCAAGAAGCTTCCGGAGCTGGTTCGCGAGTCTGTCGGGGACGAC
CGGCCCCTGACGGTGTGGACTTCAACGCTGAAGCGAACCATTGCCACGGCTCGATTTTTGCCTCCACATTACAAC
CAGCTGCAATGGAAGGCTCTGGATGAACTCGACTCGGGCGTATGTGACGGGCTGACATACCAAGAGATTAAGGAT
CGCTACCCCGAAGACTTTGCTGCTCGCGACGAGGACAAGTACAATTACCGCTACCGCGGTGGCGAGTCGTACCGC
GACGTGGTGATTCGCCTGGAGCCAATTATTATGGAGCTGGAACGCAGCGAGGACATCTTGATTGTTACTCACCAA
GCTGTGCTGCGGTGCATTTATGCCTACTTTATGAAGAAGGACCAGGCTAAGAGCCCGTGGATGAATGTGCCTCTG
CACACTCTGATTAAACTGACCCCGAGAGCCTATGGCACCGAAGAAGTGCGCTACGAGGCCAATATCCCCGCAGTC
AGCACTTGGCGCGGAAAGGGCAGCACGGCCAAGCACGAGACGCCCAATGCCGAAAGCCTCTGA
Gene >OphauB2|2539
ATGGCGTTGCTGAAGAAGTCTAACAATGGCGTGGGCGTGCAGGTCGAGGACACCAAGATATGTGTCGTCATGGTG
GGCTTGCCGGCCCGCGGCAAAAGCTACATTGCACAAATTGGTGCGTCTGCGCTGGCTGCTTGTGCCTCTTGCAAG
CCTTTTGCTGACGGGCCCGTTTGTTTAGCACAGCGTTATCTGCAGTGGCTGTCGATTCCCGCCCAGACTTTTAAC
GTGGGAAGCTATCGTCGCAACGACGCACCACAGCCCACGGCCGACTTTTTTGACACCAACAATGCCGAGGGCGAG
CGCAAGCGCCGTGCTGCCGCCCAGGCTGCTGTTGCCGACATGCTGGCTTGGTTTCGCTCGGGCGGCGTCGTGGGC
ATTCTGGATGCTACAAACTCGACCAAGGAACGCCGCAAATGGGTCCTGGACGCGTGCAGTGCCGAGGGCATCGAG
GTGCTCTTTGTCGAGAGCAAGTGCGACGACGAAGACATCATCATGGCAAATATTAGGGATGTGAAGACGACGAGC
CCCGACTACAAGGGCCAGGACCCAGAAGCGGCTGCCCAAGACTTTCGAAATCGCATCCGCAATTATGAAAAGATA
TACAAGACGATTGACGGCGACGGCGACGAGGACGATTATACCTATATCAAGATTATGGACGTTGGGAAGCAAGTC
ATTATCAACCACATTCAAGACTACTTGCAGAGCCGCATCGTCTACTACCTGATGAATCTCCACATTCGCCCTCGT
TCTGTCTGGTTGTCAAGAGTGAGTCTAGCCGTGGCTTGTATTACTGCTTTAGCCGGCTTACTAAGACTTGCTTCC
CCGGGGTAGCATGGCGAGTCACAGTATAACCTGGATGGCAGAATTGGTGGAGACACGCTCTTGTCGCCTCGCGGC
GAGCTCTATGCCAAGAAGCTTCCGGAGCTGGTTCGCGAGTCTGTCGGGGTATGTCTTTTTCTCTTCTTGTCCCCC
CCGAAATGTGACTTATTTGTGGCGCCCCTACTAACTCTGCCGTCTAGGACGACCGGCCCCTGACGGTGTGGACTT
CAACGCTGAAGCGAACCATTGCCACGGCTCGATTTTTGCCTCCACATTACAACCAGCTGCAATGGAAGGCTCTGG
ATGAACTCGACTCGGGCGTATGTGACGGGCTGACATACCAAGAGATTAAGGATCGCTACCCCGAAGACTTTGCTG
CTCGCGACGAGGACAAGTACAATTACCGCTACCGCGGTGGCGAGTCGTACCGCGACGTGGTGATTCGCCTGGAGC
CAATTATTATGGAGCTGGAACGCAGCGAGGACATCTTGATTGTTACTCACCAAGCTGTGCTGCGGTGCATTTATG
CCTACTTTATGAAGAAGGACCAGGCTAAGAGCCCGTGGATGAATGTGCCTCTGCACACTCTGATTAAACTGACCC
CGAGAGCCTATGGCACCGAAGAAGTGCGCTACGAGGCCAATATCCCCGCAGTCAGCACTTGGCGCGGAAAGGGCA
GCACGGCCAAGCACGAGACGCCCAATGCCGAAAGCCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail