Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2529
Gene name
LocationContig_18:179607..185115
Strand-
Gene length (bp)5508
Transcript length (bp)5508
Coding sequence length (bp)5508
Protein length (aa) 1836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.1E-65 98 525
PF00668 Condensation Condensation domain 6.7E-23 771 1081
PF00668 Condensation Condensation domain 4.7E-18 1449 1758
PF00550 PP-binding Phosphopantetheine attachment site 4.8E-08 666 727
PF00550 PP-binding Phosphopantetheine attachment site 1.3E-10 1309 1371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 70 1282 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 75 1178 6.0E-164
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 69 1159 3.0E-157
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 68 1194 2.0E-149
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 89 1182 2.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 70 1282 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 75 1178 6.0E-164
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 69 1159 3.0E-157
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 68 1194 2.0E-149
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 89 1182 2.0E-147
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 89 1182 4.0E-147
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 89 1182 2.0E-146
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 69 1092 3.0E-145
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 69 1077 3.0E-137
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 36 1092 1.0E-129
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 67 1074 6.0E-116
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 63 746 1.0E-115
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 78 1075 4.0E-111
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 75 1074 4.0E-106
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 69 1086 6.0E-102
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 73 1086 2.0E-101
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 69 1086 2.0E-101
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 64 837 6.0E-101
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 65 746 1.0E-98
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 88 1092 2.0E-97
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 69 1073 4.0E-97
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 88 1072 1.0E-96
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 69 725 4.0E-90
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 69 727 2.0E-89
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 64 833 2.0E-86
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 69 1093 2.0E-80
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1314 1821 4.0E-78
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 162 1055 8.0E-77
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 69 831 1.0E-76
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 93 1099 3.0E-75
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 68 736 1.0E-70
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 69 1169 7.0E-70
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 162 1071 3.0E-69
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 32 1018 8.0E-69
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 69 632 1.0E-68
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 92 1080 3.0E-66
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 76 1052 7.0E-64
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 69 1072 1.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 80 1072 6.0E-63
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 80 1072 7.0E-63
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 64 1072 8.0E-63
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 163 1074 2.0E-62
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 98 1124 1.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 77 741 1.0E-61
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 56 722 6.0E-61
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 115 1094 1.0E-60
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 69 915 1.0E-60
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 89 1072 2.0E-59
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 91 1089 6.0E-59
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 67 1075 8.0E-59
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 69 1037 3.0E-58
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 69 755 4.0E-58
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 69 1037 6.0E-58
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 67 1075 1.0E-57
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 84 742 1.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 84 1072 2.0E-57
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 90 1064 4.0E-57
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 76 1072 4.0E-57
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 89 1072 4.0E-57
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 77 765 1.0E-56
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1307 1760 2.0E-56
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 89 722 3.0E-56
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 89 722 3.0E-56
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 91 741 4.0E-56
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 79 1072 7.0E-56
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 99 1018 8.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 99 741 1.0E-55
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 77 962 1.0E-55
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 74 727 2.0E-55
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 61 1072 2.0E-55
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 63 726 3.0E-55
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 116 1074 5.0E-55
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 92 1018 5.0E-55
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 63 1113 9.0E-55
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 116 1056 1.0E-54
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 98 726 1.0E-54
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 77 727 4.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 79 913 8.0E-54
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 77 1035 8.0E-54
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 74 727 9.0E-54
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 79 1066 9.0E-54
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 730 1.0E-53
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 77 734 3.0E-53
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 67 1075 3.0E-53
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 67 1075 4.0E-53
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 83 1051 4.0E-53
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 83 1051 6.0E-53
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 77 726 7.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 64 728 1.0E-52
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 79 725 9.0E-52
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 98 1201 1.0E-51
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 87 1035 1.0E-51
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 92 727 1.0E-51
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 91 1065 1.0E-51
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 12 744 1.0E-51
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 91 1065 4.0E-51
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 83 727 7.0E-51
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 92 727 8.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 163 830 2.0E-50
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 67 739 2.0E-50
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 76 1017 4.0E-50
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 115 1074 4.0E-50
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 89 1065 5.0E-50
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 152 1041 2.0E-49
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 98 729 2.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 91 729 2.0E-49
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 64 1065 3.0E-49
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 91 727 3.0E-49
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 88 1056 4.0E-49
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1303 1784 4.0E-49
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 69 1183 9.0E-49
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 63 727 1.0E-48
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 81 726 1.0E-48
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 111 1057 2.0E-48
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 89 1072 3.0E-48
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 86 836 3.0E-48
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 95 726 1.0E-47
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 63 726 5.0E-47
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 430 1076 2.0E-46
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 98 1072 3.0E-46
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 98 1072 3.0E-46
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 92 734 3.0E-46
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 77 738 7.0E-46
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 108 717 1.0E-45
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 124 734 1.0E-45
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 108 717 2.0E-45
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 66 1092 2.0E-45
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 70 741 3.0E-45
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 81 1017 7.0E-45
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 102 726 1.0E-44
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 80 767 8.0E-44
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 79 727 2.0E-43
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 115 726 4.0E-43
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 69 727 6.0E-42
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 163 1073 7.0E-42
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 91 1066 9.0E-41
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 102 1048 1.0E-40
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 80 540 4.0E-39
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 84 913 5.0E-38
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1307 1761 6.0E-38
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 76 726 2.0E-37
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1296 1832 3.0E-37
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 76 726 6.0E-37
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 76 726 2.0E-36
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 108 740 1.0E-35
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 81 920 1.0E-35
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 100 632 4.0E-35
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 57 633 4.0E-35
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 100 726 7.0E-35
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 108 723 2.0E-34
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 86 726 2.0E-34
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 78 725 2.0E-34
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 86 726 2.0E-34
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1270 1780 2.0E-34
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 96 632 6.0E-34
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1270 1780 1.0E-33
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 174 630 1.0E-32
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 174 630 1.0E-31
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 174 630 1.0E-31
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 174 630 1.0E-31
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 174 630 1.0E-31
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 174 630 1.0E-31
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 174 630 2.0E-31
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 94 632 3.0E-31
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 174 630 3.0E-31
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 94 630 4.0E-31
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 174 630 4.0E-31
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 174 630 6.0E-31
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1264 1803 6.0E-31
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 174 630 1.0E-30
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 174 735 2.0E-29
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1281 1776 2.0E-29
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 87 726 1.0E-28
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 267 630 3.0E-28
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 81 737 4.0E-28
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 81 737 4.0E-28
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 81 737 4.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 174 632 5.0E-28
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 174 630 6.0E-28
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 174 630 7.0E-28
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 174 630 9.0E-28
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1215 1701 1.0E-27
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 98 578 1.0E-27
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 161 726 4.0E-27
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 174 726 5.0E-27
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 174 630 7.0E-27
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 174 630 9.0E-27
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 654 1092 2.0E-26
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 101 633 2.0E-26
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 174 765 3.0E-26
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 81 740 3.0E-26
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 169 739 4.0E-26
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 267 630 2.0E-25
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 267 630 2.0E-25
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 267 630 2.0E-25
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 267 630 3.0E-25
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 267 630 3.0E-25
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 100 632 3.0E-25
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 101 633 4.0E-25
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 81 705 4.0E-25
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 267 630 6.0E-25
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 174 536 7.0E-25
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 267 630 1.0E-24
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 267 630 1.0E-24
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 267 630 1.0E-24
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 267 630 1.0E-24
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1272 1725 3.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 100 633 1.0E-23
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 100 633 1.0E-23
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 100 633 1.0E-23
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 100 633 1.0E-23
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 100 633 1.0E-23
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 100 633 1.0E-23
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 100 633 1.0E-23
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 100 633 1.0E-23
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1304 1701 2.0E-23
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 100 633 2.0E-23
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 100 633 2.0E-23
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 100 633 2.0E-23
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 100 633 2.0E-23
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 100 633 2.0E-23
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 100 633 2.0E-23
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 100 633 2.0E-23
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1224 1698 3.0E-23
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 267 630 2.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 769 1182 6.0E-22
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 267 630 7.0E-22
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 267 630 7.0E-22
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 267 630 7.0E-22
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 267 630 7.0E-22
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 267 630 8.0E-22
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 267 630 8.0E-22
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 267 630 8.0E-22
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 267 630 8.0E-22
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 267 630 8.0E-22
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 267 630 9.0E-22
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 267 630 9.0E-22
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 737 1073 1.0E-21
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 675 1074 1.0E-20
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 174 711 1.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 504 1039 3.0E-20
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 81 591 6.0E-20
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 179 568 1.0E-19
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 651 1078 2.0E-19
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 771 1182 3.0E-19
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 267 632 4.0E-19
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 763 1073 1.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1157 1734 1.0E-18
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 770 1162 2.0E-18
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 770 1162 2.0E-18
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 96 632 2.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 647 1072 3.0E-18
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 750 1165 5.0E-18
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 741 1080 9.0E-18
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 763 1074 2.0E-17
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 758 1162 2.0E-17
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 770 1077 4.0E-17
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 768 1169 1.0E-16
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 763 1074 2.0E-16
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 795 1076 2.0E-16
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1310 1740 3.0E-16
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1294 1739 5.0E-16
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1300 1734 6.0E-16
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1294 1701 6.0E-16
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1298 1701 6.0E-16
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 163 721 1.0E-15
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 737 1073 1.0E-15
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1390 1734 3.0E-15
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1419 1734 3.0E-15
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 771 1076 3.0E-15
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1294 1739 6.0E-15
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 860 1081 7.0E-15
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1419 1739 2.0E-14
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 160 635 3.0E-14
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 773 1073 3.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1307 1734 5.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1317 1825 7.0E-14
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 768 1163 1.0E-13
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 766 1077 3.0E-13
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1312 1719 3.0E-13
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1418 1734 4.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1315 1731 4.0E-13
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 252 635 7.0E-13
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 262 631 7.0E-13
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1447 1734 7.0E-13
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 262 633 9.0E-13
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 768 1077 1.0E-12
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1434 1738 1.0E-12
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 855 1081 1.0E-12
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 262 631 2.0E-12
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1418 1738 2.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1307 1734 3.0E-12
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 262 631 4.0E-12
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 262 631 4.0E-12
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 725 1128 4.0E-12
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 262 633 5.0E-12
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 262 631 5.0E-12
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 262 631 5.0E-12
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 262 631 5.0E-12
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 262 631 5.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1532 1734 5.0E-12
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 262 631 6.0E-12
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 262 631 6.0E-12
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 262 631 6.0E-12
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 262 631 6.0E-12
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 268 635 6.0E-12
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 254 631 6.0E-12
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 262 631 8.0E-12
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 262 631 8.0E-12
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 262 626 9.0E-12
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 262 626 9.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 765 1074 9.0E-12
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 262 631 1.0E-11
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 262 631 1.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 722 1073 1.0E-11
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 262 626 2.0E-11
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 255 635 2.0E-11
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 262 626 2.0E-11
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 262 626 2.0E-11
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 259 635 2.0E-11
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 262 633 2.0E-11
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 771 1073 2.0E-11
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 250 635 3.0E-11
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 262 633 3.0E-11
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 771 1059 3.0E-11
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1460 1747 3.0E-11
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1294 1703 3.0E-11
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 598 918 6.0E-11
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 245 632 7.0E-11
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 255 635 7.0E-11
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1419 1753 7.0E-11
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1269 1573 1.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1460 1736 2.0E-10
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 268 626 3.0E-10
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 268 626 3.0E-10
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 268 626 3.0E-10
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 268 626 3.0E-10
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1395 1734 3.0E-10
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 114 630 4.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1312 1716 5.0E-10
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 88 536 5.0E-10
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 88 536 5.0E-10
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 268 626 7.0E-10
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 268 626 7.0E-10
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 268 626 9.0E-10
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 268 626 9.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 769 1165 1.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 267 726 1.0E-09
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 771 1081 1.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 251 632 2.0E-09
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 116 633 2.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1416 1736 2.0E-09
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1307 1606 2.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1419 1734 4.0E-09
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 245 535 4.0E-09
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 265 632 4.0E-09
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1460 1734 4.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1293 1376 5.0E-09
sp|Q17WR1|ACSA_HELAH Acetyl-coenzyme A synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=acsA PE=3 SV=1 119 633 5.0E-09
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 265 632 8.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1302 1704 1.0E-08
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 656 1039 1.0E-08
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 268 632 1.0E-08
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 262 632 2.0E-08
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 262 632 2.0E-08
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 268 540 2.0E-08
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 268 540 2.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 255 632 2.0E-08
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 268 632 2.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1455 1734 2.0E-08
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 268 540 3.0E-08
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 202 540 3.0E-08
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 202 540 4.0E-08
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 268 540 4.0E-08
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 268 540 4.0E-08
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 268 540 4.0E-08
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 268 540 4.0E-08
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 265 632 4.0E-08
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 268 540 4.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1307 1393 4.0E-08
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 230 492 5.0E-08
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 267 538 5.0E-08
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 266 637 5.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 163 644 7.0E-08
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 268 536 1.0E-07
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 202 540 1.0E-07
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 265 635 2.0E-07
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 265 639 2.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1293 1478 2.0E-07
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1300 1378 2.0E-07
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 268 540 3.0E-07
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 268 540 3.0E-07
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 262 632 3.0E-07
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 267 483 3.0E-07
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 268 540 3.0E-07
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 115 631 3.0E-07
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 266 637 4.0E-07
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 263 536 4.0E-07
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 266 637 5.0E-07
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 268 535 6.0E-07
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 266 637 6.0E-07
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 268 492 7.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 266 637 7.0E-07
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 268 632 7.0E-07
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 266 637 8.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 175 535 8.0E-07
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 266 637 9.0E-07
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 202 536 1.0E-06
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 268 632 1.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1293 1478 2.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1310 1738 2.0E-06
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 266 637 2.0E-06
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 266 637 2.0E-06
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 266 637 2.0E-06
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 266 637 2.0E-06
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1293 1371 3.0E-06
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 265 633 3.0E-06
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 265 535 5.0E-06
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 268 540 6.0E-06
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 268 536 6.0E-06
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 262 539 7.0E-06
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 266 637 7.0E-06
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 268 536 7.0E-06
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 268 536 9.0E-06
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 267 535 9.0E-06
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 267 535 9.0E-06
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 268 540 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2529
MDTLVERLAMTDTTADGGFQDEKQELENGEGQDKDETQAMKNGMEQGEHDKQDKESGKEEGEPDERQSISAADLE
QIWQWNKTVPETIEACIHERILERARRHPLAEAVRAWDGRLTYGELDDYSGRLARVLGRHMARGANGTGPDDARV
HDTEANGSSILCVPLCFEKSVWTVVAVLGVLRSGAAFSLTDASQPEARLRCIVEQTHARIVVTSVAQGDLGRRIC
PHGTVICLSRGMLDQQEQEQEQGQGQVQHYEAAAAWPASPMYIIFTSGSTGRPKGVVVSHQNYLSGAVPRAQAVG
YNEASAVFDFPSYAFDVSIDCMLCTLAGGGVVCVPSDEDRVNRLSEAIRSSGANMVHMTPSVARLLDADIMPSLR
VLGLGGEAVSASDAAAWSRHTRLVIAYGPSECTVACTVNWELSRSRGIGVGVGGVTWIVDAQCHDVLMPIGAVGE
LLIEGPVVAMGYLDEPEQTSQVFIEAPGWLAAGHEGVAAGRGGRLYKTGDLVRYEAKGGGMLEFVGRKDQQVKLR
GQRVELAEVEHHVRACLPAGTRVAAEVIESGRGRVATLVAFVCEGHEADQGNEGVVEASRELRAALAALDSAMGS
RAPRYMVPAACLTLGRMPSLVSGKTDRRRLREIGEAICRSRLLEGGHEGHEGQEEEEAQTEKEKLLVQAWTQVLG
NDKRGLFRQSNFFALGGDSLRAMKLVSAARRLGLSLSVGEVFTTPTLAGMAQASSTAAAGADEDDIAPFSLLAKD
WPADEARQQTAALCGLPSDAVQDVYACTPLQEALMALSAKVAEAYVAQRLVELCDAATAERLGAAVQQAQRQSSI
LRTRIVQVPGRGLFQVVVGAAWAWHLDSGRSLDDYLATDRARRMELGQPLARFAVVQGARPSFVVTMHHSLYDGW
CMPLIVDSINRAFVHGQPRVRAADMRHFMRYLASRDQAASQDFWRRRLQGATGLQFPLLPWHGYQPRADSLLEEY
VALDAGGGATTLAATIRAAWTLVAARYTANPHVVFGETLTGRNAPIAAADEIEGPLITTVPVHVVVDAEASLDAF
VHALQRQTVAQMAHEHMGLQNIRRLSSDAREACQLGTGLVLQPSTHRAAPDALPASRLVPASDDEAAREALKFNT
YAVMLVCSMDAHGFLVMASFDAKTVHADLMQRVLGQLKTVARLVHSGRCGSMRVGDVVRATAADLTLLEAYAAAP
RAHGLACVPRQGVEALHVVDPADASVLQPVGAVGELVVQAANPLPLTELARRPSWLKASSSSSDSRLFCTGQLVR
YNGEGRLQPVEHAQEQQPAPSSQRLSAASHKQRRLGRLWSRVLDIAQDDIGLDDSFFLLGGDSISAMKLVAEARL
EGIGLTVMQIFETRRLFDMAQAMQEQQQQHDEAAQHDEAVGLSLLAVDDADAFVRDVVQPQLLEPGITIEHVLPA
RPLQHVAVQGTVQEPRFAVRYELMFFDAPVDAARLARACQALVDAHEILRTLFVQHEAQCLAVATRGLRVRFEEH
CVDCDAQLDEYARHWCRLNVRSSMPHGSAFVAWLLVRARLGRRACLVWRISHAQYDELCLPVMLRHLSALYQGDD
DAAARAAIPPATPFSSYVAHVLRHAIPASTPYWRRLLAGSSLSILRPPEPVTRTAHFAIQTTLDISSCPLDVTPA
TLPTASWALCLARRLATRDVVFGEVVSGRNISSPSPHAVVGPCWQYIPVRVCFQPTWRACDLLAHVQRQHVASAA
HEAMAFAEIVSRCTDWDAESTPRWFDSVVHQDVAHVTSLPFAACERMETLYPHQEPLDEWKIQAYIDAGAMTLEI
VTVESWGEYAKGLLDDLAAAVRVLLDNGAAPLCLD*
Coding >OphauB2|2529
ATGGACACGTTGGTGGAGCGACTGGCAATGACGGACACGACGGCCGATGGTGGCTTTCAAGATGAGAAGCAAGAG
TTGGAGAATGGAGAGGGACAAGACAAAGACGAGACGCAAGCAATGAAGAATGGAATGGAACAGGGCGAACATGAC
AAGCAAGACAAGGAGAGTGGAAAGGAAGAGGGCGAGCCTGACGAAAGACAAAGCATTAGCGCTGCGGACCTGGAA
CAGATATGGCAGTGGAACAAGACAGTGCCCGAGACGATTGAGGCATGTATTCATGAACGCATCTTGGAGCGTGCG
CGGCGGCACCCTCTGGCCGAGGCGGTGCGGGCATGGGACGGGCGACTGACATATGGCGAACTGGACGACTATTCG
GGACGACTGGCTCGCGTCTTGGGCCGGCACATGGCGAGGGGAGCTAATGGCACTGGACCTGACGACGCTCGAGTC
CACGACACTGAAGCCAATGGCAGCTCCATTTTGTGCGTGCCGCTGTGCTTTGAAAAGTCTGTGTGGACCGTTGTT
GCCGTCTTGGGGGTGCTACGCTCGGGCGCAGCCTTTAGCCTGACAGACGCAAGCCAGCCAGAGGCGCGGCTGCGG
TGCATTGTCGAGCAAACGCATGCGCGCATTGTGGTTACTTCGGTGGCTCAGGGCGACTTGGGACGACGCATCTGC
CCCCATGGCACCGTGATTTGCCTGTCGCGAGGCATGCTGGATCAACAAGAGCAAGAGCAAGAGCAAGGGCAAGGC
CAGGTCCAACACTATGAAGCGGCGGCGGCGTGGCCAGCATCACCAATGTACATCATCTTCACATCAGGCAGCACA
GGGCGTCCCAAGGGCGTCGTCGTGTCGCATCAAAACTACCTCAGCGGGGCGGTGCCACGTGCGCAGGCAGTGGGC
TACAACGAGGCCTCGGCCGTGTTTGACTTTCCCTCGTATGCCTTTGACGTGAGCATCGACTGTATGCTGTGCACG
CTGGCTGGTGGGGGCGTGGTGTGCGTGCCGTCGGACGAGGACCGGGTCAACAGGCTGAGCGAGGCGATTCGCAGC
AGCGGGGCAAACATGGTGCACATGACGCCGTCGGTGGCGCGTTTGCTGGATGCAGACATTATGCCGTCGCTCAGG
GTGCTTGGGCTGGGCGGGGAGGCCGTGTCGGCGAGCGACGCTGCCGCCTGGAGCCGGCACACGCGCCTCGTCATT
GCCTATGGCCCTTCAGAGTGCACCGTGGCGTGCACCGTCAACTGGGAGCTGAGTCGGTCGCGGGGCATTGGCGTG
GGCGTGGGAGGCGTGACGTGGATTGTTGACGCGCAATGCCACGACGTGCTGATGCCCATTGGTGCTGTGGGCGAG
CTGCTCATTGAGGGGCCCGTGGTGGCCATGGGATACCTTGACGAGCCAGAGCAGACGAGCCAAGTCTTTATTGAG
GCCCCAGGCTGGCTGGCGGCAGGCCACGAGGGCGTGGCTGCGGGCCGCGGCGGACGCCTGTACAAGACGGGGGAC
CTTGTGCGATACGAGGCCAAGGGCGGCGGCATGCTCGAGTTTGTAGGGCGCAAGGACCAGCAGGTCAAGCTGCGG
GGGCAGCGGGTGGAGCTGGCCGAGGTGGAACACCATGTGCGCGCCTGTCTGCCGGCCGGGACGCGCGTTGCGGCC
GAAGTGATTGAGTCGGGCCGTGGACGAGTGGCGACGCTGGTGGCGTTTGTGTGCGAGGGCCACGAGGCAGACCAA
GGCAACGAGGGCGTGGTGGAGGCGTCGCGGGAGCTAAGGGCGGCGCTGGCGGCTCTCGACTCGGCCATGGGCTCG
CGAGCGCCACGCTACATGGTGCCGGCGGCGTGTCTGACGCTGGGCCGCATGCCGTCGCTGGTGTCGGGCAAGACG
GACCGCAGGCGGCTGCGCGAGATTGGCGAGGCCATTTGTCGCTCGAGGCTGCTGGAGGGGGGGCATGAGGGGCAC
GAGGGGCAAGAGGAAGAGGAGGCGCAGACGGAAAAGGAAAAGCTGCTGGTGCAGGCGTGGACGCAGGTGCTGGGC
AACGACAAGAGGGGCCTCTTTCGGCAGTCCAACTTTTTTGCGCTGGGCGGCGACTCGCTGCGGGCCATGAAGCTC
GTGTCGGCGGCGCGACGGCTCGGTCTGTCGCTCAGCGTGGGCGAGGTGTTTACGACGCCCACTCTGGCGGGCATG
GCGCAAGCATCGAGCACAGCAGCAGCAGGCGCAGACGAGGACGACATTGCGCCCTTTTCGCTCCTGGCCAAGGAC
TGGCCGGCCGACGAGGCGCGGCAACAGACGGCGGCGCTGTGCGGGCTCCCGAGCGACGCGGTTCAAGACGTCTAT
GCCTGCACGCCGCTGCAAGAGGCGCTCATGGCTCTGTCGGCAAAGGTGGCCGAGGCATACGTGGCGCAGCGCCTT
GTTGAGCTTTGCGACGCGGCCACGGCTGAGCGGCTCGGCGCAGCGGTGCAGCAGGCACAGCGCCAGTCGAGCATC
CTGCGCACGCGCATCGTCCAGGTGCCCGGGCGTGGCCTGTTCCAGGTGGTGGTGGGCGCAGCCTGGGCGTGGCAT
CTCGACTCGGGGCGCAGCCTCGACGACTACCTGGCGACGGACCGCGCGCGACGCATGGAGCTCGGGCAGCCGCTG
GCGCGCTTTGCCGTGGTGCAGGGAGCGCGGCCCAGCTTTGTGGTGACGATGCACCACTCGCTCTATGACGGGTGG
TGCATGCCGCTCATTGTCGACAGCATCAACCGCGCCTTTGTGCATGGGCAGCCGCGGGTGCGCGCAGCCGACATG
AGGCACTTTATGCGCTACCTGGCGTCGCGCGACCAGGCCGCGTCGCAAGACTTTTGGCGGCGCCGGCTCCAGGGC
GCCACGGGGCTGCAGTTCCCCCTGCTGCCCTGGCACGGATACCAGCCGCGCGCCGACTCGCTGCTCGAGGAGTAT
GTGGCACTGGATGCTGGCGGCGGCGCCACCACGCTGGCCGCCACCATTCGCGCAGCCTGGACCCTGGTGGCTGCG
CGCTACACGGCCAACCCTCATGTCGTCTTTGGCGAGACGCTGACGGGCCGCAACGCGCCCATTGCCGCCGCCGAC
GAGATTGAGGGCCCCCTCATCACCACGGTGCCCGTCCATGTCGTGGTGGATGCCGAGGCGTCCCTCGATGCCTTT
GTGCACGCTCTGCAGCGTCAGACGGTGGCCCAGATGGCCCACGAGCACATGGGCCTGCAAAACATTCGCCGCCTC
AGCTCCGACGCCCGCGAGGCCTGCCAGCTGGGCACCGGCCTTGTCCTGCAGCCGAGCACGCACCGCGCCGCGCCG
GATGCTCTGCCCGCCAGCCGCCTGGTGCCCGCCAGCGACGACGAGGCGGCGCGCGAGGCCCTCAAGTTTAACACG
TATGCCGTGATGCTTGTGTGCTCCATGGATGCCCACGGCTTCCTCGTCATGGCCAGCTTTGACGCCAAGACGGTG
CATGCCGACTTGATGCAGCGCGTTCTTGGCCAGCTCAAGACGGTGGCGCGCCTTGTCCACAGCGGCCGTTGTGGC
AGCATGCGCGTTGGCGACGTGGTGCGTGCTACCGCTGCCGACTTGACCCTGCTAGAGGCTTATGCCGCGGCTCCT
CGTGCCCATGGCCTCGCCTGTGTGCCACGCCAGGGCGTCGAGGCGCTTCATGTAGTCGACCCGGCCGACGCGAGC
GTGCTGCAGCCAGTGGGAGCCGTGGGAGAGCTGGTGGTGCAGGCCGCCAACCCCCTACCGCTAACGGAGCTGGCA
AGGCGGCCCAGCTGGCTCAAGGCTAGCAGCAGTAGTAGTGACTCGCGCCTCTTTTGCACCGGGCAGCTGGTGCGC
TACAATGGCGAGGGCCGTCTGCAGCCTGTTGAGCATGCACAAGAGCAGCAGCCAGCGCCGTCGTCACAGCGCCTA
TCAGCGGCATCGCACAAGCAGCGTCGCCTAGGCCGGCTATGGAGCCGGGTGCTGGACATTGCGCAAGACGACATT
GGCCTCGACGACAGCTTCTTCTTGCTGGGCGGCGACTCCATCAGCGCCATGAAGCTGGTGGCGGAGGCGCGGCTC
GAGGGGATTGGGCTGACGGTGATGCAAATCTTTGAGACGCGGCGCCTCTTTGACATGGCGCAGGCGATGCAGGAG
CAGCAGCAGCAGCACGACGAGGCGGCGCAGCACGACGAGGCGGTGGGTTTATCGCTGCTCGCCGTGGACGACGCA
GACGCCTTTGTGCGCGACGTGGTGCAGCCGCAGCTGCTCGAGCCGGGCATCACCATTGAGCACGTCTTGCCGGCG
CGGCCGCTGCAGCACGTGGCGGTGCAGGGCACGGTGCAGGAGCCACGCTTTGCCGTGCGCTACGAGCTCATGTTT
TTCGACGCGCCCGTGGATGCGGCACGTCTGGCGCGGGCCTGCCAGGCGCTGGTGGACGCGCACGAGATTCTGCGC
ACCCTCTTTGTCCAGCACGAGGCGCAGTGTCTGGCCGTGGCCACGAGGGGCCTGCGCGTGCGCTTCGAGGAGCAC
TGCGTCGACTGCGATGCCCAGCTTGACGAGTATGCGCGCCATTGGTGTCGCCTCAATGTGCGCTCCAGCATGCCT
CATGGCTCGGCCTTTGTGGCCTGGCTGCTGGTGCGTGCGCGTCTCGGTCGTCGCGCCTGTCTGGTCTGGCGCATC
TCGCATGCGCAGTATGATGAGCTGTGTCTGCCCGTCATGCTGCGCCACCTCTCGGCCCTCTACCAAGGCGATGAC
GATGCTGCTGCTCGAGCTGCCATCCCCCCAGCCACGCCCTTTTCCAGCTATGTTGCCCACGTCTTGCGCCACGCC
ATCCCTGCCAGCACGCCCTACTGGCGCCGTCTCCTGGCCGGCTCATCTCTCTCCATTCTCCGGCCCCCCGAACCA
GTCACCCGCACCGCCCACTTTGCCATTCAAACCACGCTCGACATCTCGTCTTGTCCGCTCGACGTCACGCCCGCC
ACCCTCCCCACCGCCTCTTGGGCCCTCTGCCTCGCCCGCCGCCTGGCCACCCGCGACGTCGTCTTTGGCGAAGTC
GTTTCCGGCCGCAACATTTCCTCTCCATCTCCCCACGCCGTCGTTGGTCCTTGCTGGCAATATATCCCCGTCCGC
GTATGCTTCCAGCCAACATGGCGTGCTTGCGATTTGCTCGCCCACGTGCAGCGCCAACACGTCGCCTCTGCCGCC
CACGAAGCCATGGCCTTTGCAGAAATCGTAAGCCGCTGCACAGACTGGGATGCAGAGTCGACGCCCCGGTGGTTC
GACTCGGTGGTGCATCAAGATGTCGCCCACGTCACCTCTTTACCATTTGCCGCGTGTGAGCGCATGGAGACGCTG
TATCCCCACCAAGAGCCGCTGGATGAGTGGAAGATTCAGGCCTATATTGATGCAGGTGCAATGACGCTGGAAATT
GTCACGGTGGAGAGCTGGGGGGAGTATGCAAAGGGCTTGCTGGACGATTTGGCAGCCGCCGTGCGCGTCTTGCTT
GATAATGGAGCCGCCCCGCTTTGTCTAGATTGA
Transcript >OphauB2|2529
ATGGACACGTTGGTGGAGCGACTGGCAATGACGGACACGACGGCCGATGGTGGCTTTCAAGATGAGAAGCAAGAG
TTGGAGAATGGAGAGGGACAAGACAAAGACGAGACGCAAGCAATGAAGAATGGAATGGAACAGGGCGAACATGAC
AAGCAAGACAAGGAGAGTGGAAAGGAAGAGGGCGAGCCTGACGAAAGACAAAGCATTAGCGCTGCGGACCTGGAA
CAGATATGGCAGTGGAACAAGACAGTGCCCGAGACGATTGAGGCATGTATTCATGAACGCATCTTGGAGCGTGCG
CGGCGGCACCCTCTGGCCGAGGCGGTGCGGGCATGGGACGGGCGACTGACATATGGCGAACTGGACGACTATTCG
GGACGACTGGCTCGCGTCTTGGGCCGGCACATGGCGAGGGGAGCTAATGGCACTGGACCTGACGACGCTCGAGTC
CACGACACTGAAGCCAATGGCAGCTCCATTTTGTGCGTGCCGCTGTGCTTTGAAAAGTCTGTGTGGACCGTTGTT
GCCGTCTTGGGGGTGCTACGCTCGGGCGCAGCCTTTAGCCTGACAGACGCAAGCCAGCCAGAGGCGCGGCTGCGG
TGCATTGTCGAGCAAACGCATGCGCGCATTGTGGTTACTTCGGTGGCTCAGGGCGACTTGGGACGACGCATCTGC
CCCCATGGCACCGTGATTTGCCTGTCGCGAGGCATGCTGGATCAACAAGAGCAAGAGCAAGAGCAAGGGCAAGGC
CAGGTCCAACACTATGAAGCGGCGGCGGCGTGGCCAGCATCACCAATGTACATCATCTTCACATCAGGCAGCACA
GGGCGTCCCAAGGGCGTCGTCGTGTCGCATCAAAACTACCTCAGCGGGGCGGTGCCACGTGCGCAGGCAGTGGGC
TACAACGAGGCCTCGGCCGTGTTTGACTTTCCCTCGTATGCCTTTGACGTGAGCATCGACTGTATGCTGTGCACG
CTGGCTGGTGGGGGCGTGGTGTGCGTGCCGTCGGACGAGGACCGGGTCAACAGGCTGAGCGAGGCGATTCGCAGC
AGCGGGGCAAACATGGTGCACATGACGCCGTCGGTGGCGCGTTTGCTGGATGCAGACATTATGCCGTCGCTCAGG
GTGCTTGGGCTGGGCGGGGAGGCCGTGTCGGCGAGCGACGCTGCCGCCTGGAGCCGGCACACGCGCCTCGTCATT
GCCTATGGCCCTTCAGAGTGCACCGTGGCGTGCACCGTCAACTGGGAGCTGAGTCGGTCGCGGGGCATTGGCGTG
GGCGTGGGAGGCGTGACGTGGATTGTTGACGCGCAATGCCACGACGTGCTGATGCCCATTGGTGCTGTGGGCGAG
CTGCTCATTGAGGGGCCCGTGGTGGCCATGGGATACCTTGACGAGCCAGAGCAGACGAGCCAAGTCTTTATTGAG
GCCCCAGGCTGGCTGGCGGCAGGCCACGAGGGCGTGGCTGCGGGCCGCGGCGGACGCCTGTACAAGACGGGGGAC
CTTGTGCGATACGAGGCCAAGGGCGGCGGCATGCTCGAGTTTGTAGGGCGCAAGGACCAGCAGGTCAAGCTGCGG
GGGCAGCGGGTGGAGCTGGCCGAGGTGGAACACCATGTGCGCGCCTGTCTGCCGGCCGGGACGCGCGTTGCGGCC
GAAGTGATTGAGTCGGGCCGTGGACGAGTGGCGACGCTGGTGGCGTTTGTGTGCGAGGGCCACGAGGCAGACCAA
GGCAACGAGGGCGTGGTGGAGGCGTCGCGGGAGCTAAGGGCGGCGCTGGCGGCTCTCGACTCGGCCATGGGCTCG
CGAGCGCCACGCTACATGGTGCCGGCGGCGTGTCTGACGCTGGGCCGCATGCCGTCGCTGGTGTCGGGCAAGACG
GACCGCAGGCGGCTGCGCGAGATTGGCGAGGCCATTTGTCGCTCGAGGCTGCTGGAGGGGGGGCATGAGGGGCAC
GAGGGGCAAGAGGAAGAGGAGGCGCAGACGGAAAAGGAAAAGCTGCTGGTGCAGGCGTGGACGCAGGTGCTGGGC
AACGACAAGAGGGGCCTCTTTCGGCAGTCCAACTTTTTTGCGCTGGGCGGCGACTCGCTGCGGGCCATGAAGCTC
GTGTCGGCGGCGCGACGGCTCGGTCTGTCGCTCAGCGTGGGCGAGGTGTTTACGACGCCCACTCTGGCGGGCATG
GCGCAAGCATCGAGCACAGCAGCAGCAGGCGCAGACGAGGACGACATTGCGCCCTTTTCGCTCCTGGCCAAGGAC
TGGCCGGCCGACGAGGCGCGGCAACAGACGGCGGCGCTGTGCGGGCTCCCGAGCGACGCGGTTCAAGACGTCTAT
GCCTGCACGCCGCTGCAAGAGGCGCTCATGGCTCTGTCGGCAAAGGTGGCCGAGGCATACGTGGCGCAGCGCCTT
GTTGAGCTTTGCGACGCGGCCACGGCTGAGCGGCTCGGCGCAGCGGTGCAGCAGGCACAGCGCCAGTCGAGCATC
CTGCGCACGCGCATCGTCCAGGTGCCCGGGCGTGGCCTGTTCCAGGTGGTGGTGGGCGCAGCCTGGGCGTGGCAT
CTCGACTCGGGGCGCAGCCTCGACGACTACCTGGCGACGGACCGCGCGCGACGCATGGAGCTCGGGCAGCCGCTG
GCGCGCTTTGCCGTGGTGCAGGGAGCGCGGCCCAGCTTTGTGGTGACGATGCACCACTCGCTCTATGACGGGTGG
TGCATGCCGCTCATTGTCGACAGCATCAACCGCGCCTTTGTGCATGGGCAGCCGCGGGTGCGCGCAGCCGACATG
AGGCACTTTATGCGCTACCTGGCGTCGCGCGACCAGGCCGCGTCGCAAGACTTTTGGCGGCGCCGGCTCCAGGGC
GCCACGGGGCTGCAGTTCCCCCTGCTGCCCTGGCACGGATACCAGCCGCGCGCCGACTCGCTGCTCGAGGAGTAT
GTGGCACTGGATGCTGGCGGCGGCGCCACCACGCTGGCCGCCACCATTCGCGCAGCCTGGACCCTGGTGGCTGCG
CGCTACACGGCCAACCCTCATGTCGTCTTTGGCGAGACGCTGACGGGCCGCAACGCGCCCATTGCCGCCGCCGAC
GAGATTGAGGGCCCCCTCATCACCACGGTGCCCGTCCATGTCGTGGTGGATGCCGAGGCGTCCCTCGATGCCTTT
GTGCACGCTCTGCAGCGTCAGACGGTGGCCCAGATGGCCCACGAGCACATGGGCCTGCAAAACATTCGCCGCCTC
AGCTCCGACGCCCGCGAGGCCTGCCAGCTGGGCACCGGCCTTGTCCTGCAGCCGAGCACGCACCGCGCCGCGCCG
GATGCTCTGCCCGCCAGCCGCCTGGTGCCCGCCAGCGACGACGAGGCGGCGCGCGAGGCCCTCAAGTTTAACACG
TATGCCGTGATGCTTGTGTGCTCCATGGATGCCCACGGCTTCCTCGTCATGGCCAGCTTTGACGCCAAGACGGTG
CATGCCGACTTGATGCAGCGCGTTCTTGGCCAGCTCAAGACGGTGGCGCGCCTTGTCCACAGCGGCCGTTGTGGC
AGCATGCGCGTTGGCGACGTGGTGCGTGCTACCGCTGCCGACTTGACCCTGCTAGAGGCTTATGCCGCGGCTCCT
CGTGCCCATGGCCTCGCCTGTGTGCCACGCCAGGGCGTCGAGGCGCTTCATGTAGTCGACCCGGCCGACGCGAGC
GTGCTGCAGCCAGTGGGAGCCGTGGGAGAGCTGGTGGTGCAGGCCGCCAACCCCCTACCGCTAACGGAGCTGGCA
AGGCGGCCCAGCTGGCTCAAGGCTAGCAGCAGTAGTAGTGACTCGCGCCTCTTTTGCACCGGGCAGCTGGTGCGC
TACAATGGCGAGGGCCGTCTGCAGCCTGTTGAGCATGCACAAGAGCAGCAGCCAGCGCCGTCGTCACAGCGCCTA
TCAGCGGCATCGCACAAGCAGCGTCGCCTAGGCCGGCTATGGAGCCGGGTGCTGGACATTGCGCAAGACGACATT
GGCCTCGACGACAGCTTCTTCTTGCTGGGCGGCGACTCCATCAGCGCCATGAAGCTGGTGGCGGAGGCGCGGCTC
GAGGGGATTGGGCTGACGGTGATGCAAATCTTTGAGACGCGGCGCCTCTTTGACATGGCGCAGGCGATGCAGGAG
CAGCAGCAGCAGCACGACGAGGCGGCGCAGCACGACGAGGCGGTGGGTTTATCGCTGCTCGCCGTGGACGACGCA
GACGCCTTTGTGCGCGACGTGGTGCAGCCGCAGCTGCTCGAGCCGGGCATCACCATTGAGCACGTCTTGCCGGCG
CGGCCGCTGCAGCACGTGGCGGTGCAGGGCACGGTGCAGGAGCCACGCTTTGCCGTGCGCTACGAGCTCATGTTT
TTCGACGCGCCCGTGGATGCGGCACGTCTGGCGCGGGCCTGCCAGGCGCTGGTGGACGCGCACGAGATTCTGCGC
ACCCTCTTTGTCCAGCACGAGGCGCAGTGTCTGGCCGTGGCCACGAGGGGCCTGCGCGTGCGCTTCGAGGAGCAC
TGCGTCGACTGCGATGCCCAGCTTGACGAGTATGCGCGCCATTGGTGTCGCCTCAATGTGCGCTCCAGCATGCCT
CATGGCTCGGCCTTTGTGGCCTGGCTGCTGGTGCGTGCGCGTCTCGGTCGTCGCGCCTGTCTGGTCTGGCGCATC
TCGCATGCGCAGTATGATGAGCTGTGTCTGCCCGTCATGCTGCGCCACCTCTCGGCCCTCTACCAAGGCGATGAC
GATGCTGCTGCTCGAGCTGCCATCCCCCCAGCCACGCCCTTTTCCAGCTATGTTGCCCACGTCTTGCGCCACGCC
ATCCCTGCCAGCACGCCCTACTGGCGCCGTCTCCTGGCCGGCTCATCTCTCTCCATTCTCCGGCCCCCCGAACCA
GTCACCCGCACCGCCCACTTTGCCATTCAAACCACGCTCGACATCTCGTCTTGTCCGCTCGACGTCACGCCCGCC
ACCCTCCCCACCGCCTCTTGGGCCCTCTGCCTCGCCCGCCGCCTGGCCACCCGCGACGTCGTCTTTGGCGAAGTC
GTTTCCGGCCGCAACATTTCCTCTCCATCTCCCCACGCCGTCGTTGGTCCTTGCTGGCAATATATCCCCGTCCGC
GTATGCTTCCAGCCAACATGGCGTGCTTGCGATTTGCTCGCCCACGTGCAGCGCCAACACGTCGCCTCTGCCGCC
CACGAAGCCATGGCCTTTGCAGAAATCGTAAGCCGCTGCACAGACTGGGATGCAGAGTCGACGCCCCGGTGGTTC
GACTCGGTGGTGCATCAAGATGTCGCCCACGTCACCTCTTTACCATTTGCCGCGTGTGAGCGCATGGAGACGCTG
TATCCCCACCAAGAGCCGCTGGATGAGTGGAAGATTCAGGCCTATATTGATGCAGGTGCAATGACGCTGGAAATT
GTCACGGTGGAGAGCTGGGGGGAGTATGCAAAGGGCTTGCTGGACGATTTGGCAGCCGCCGTGCGCGTCTTGCTT
GATAATGGAGCCGCCCCGCTTTGTCTAGATTGA
Gene >OphauB2|2529
ATGGACACGTTGGTGGAGCGACTGGCAATGACGGACACGACGGCCGATGGTGGCTTTCAAGATGAGAAGCAAGAG
TTGGAGAATGGAGAGGGACAAGACAAAGACGAGACGCAAGCAATGAAGAATGGAATGGAACAGGGCGAACATGAC
AAGCAAGACAAGGAGAGTGGAAAGGAAGAGGGCGAGCCTGACGAAAGACAAAGCATTAGCGCTGCGGACCTGGAA
CAGATATGGCAGTGGAACAAGACAGTGCCCGAGACGATTGAGGCATGTATTCATGAACGCATCTTGGAGCGTGCG
CGGCGGCACCCTCTGGCCGAGGCGGTGCGGGCATGGGACGGGCGACTGACATATGGCGAACTGGACGACTATTCG
GGACGACTGGCTCGCGTCTTGGGCCGGCACATGGCGAGGGGAGCTAATGGCACTGGACCTGACGACGCTCGAGTC
CACGACACTGAAGCCAATGGCAGCTCCATTTTGTGCGTGCCGCTGTGCTTTGAAAAGTCTGTGTGGACCGTTGTT
GCCGTCTTGGGGGTGCTACGCTCGGGCGCAGCCTTTAGCCTGACAGACGCAAGCCAGCCAGAGGCGCGGCTGCGG
TGCATTGTCGAGCAAACGCATGCGCGCATTGTGGTTACTTCGGTGGCTCAGGGCGACTTGGGACGACGCATCTGC
CCCCATGGCACCGTGATTTGCCTGTCGCGAGGCATGCTGGATCAACAAGAGCAAGAGCAAGAGCAAGGGCAAGGC
CAGGTCCAACACTATGAAGCGGCGGCGGCGTGGCCAGCATCACCAATGTACATCATCTTCACATCAGGCAGCACA
GGGCGTCCCAAGGGCGTCGTCGTGTCGCATCAAAACTACCTCAGCGGGGCGGTGCCACGTGCGCAGGCAGTGGGC
TACAACGAGGCCTCGGCCGTGTTTGACTTTCCCTCGTATGCCTTTGACGTGAGCATCGACTGTATGCTGTGCACG
CTGGCTGGTGGGGGCGTGGTGTGCGTGCCGTCGGACGAGGACCGGGTCAACAGGCTGAGCGAGGCGATTCGCAGC
AGCGGGGCAAACATGGTGCACATGACGCCGTCGGTGGCGCGTTTGCTGGATGCAGACATTATGCCGTCGCTCAGG
GTGCTTGGGCTGGGCGGGGAGGCCGTGTCGGCGAGCGACGCTGCCGCCTGGAGCCGGCACACGCGCCTCGTCATT
GCCTATGGCCCTTCAGAGTGCACCGTGGCGTGCACCGTCAACTGGGAGCTGAGTCGGTCGCGGGGCATTGGCGTG
GGCGTGGGAGGCGTGACGTGGATTGTTGACGCGCAATGCCACGACGTGCTGATGCCCATTGGTGCTGTGGGCGAG
CTGCTCATTGAGGGGCCCGTGGTGGCCATGGGATACCTTGACGAGCCAGAGCAGACGAGCCAAGTCTTTATTGAG
GCCCCAGGCTGGCTGGCGGCAGGCCACGAGGGCGTGGCTGCGGGCCGCGGCGGACGCCTGTACAAGACGGGGGAC
CTTGTGCGATACGAGGCCAAGGGCGGCGGCATGCTCGAGTTTGTAGGGCGCAAGGACCAGCAGGTCAAGCTGCGG
GGGCAGCGGGTGGAGCTGGCCGAGGTGGAACACCATGTGCGCGCCTGTCTGCCGGCCGGGACGCGCGTTGCGGCC
GAAGTGATTGAGTCGGGCCGTGGACGAGTGGCGACGCTGGTGGCGTTTGTGTGCGAGGGCCACGAGGCAGACCAA
GGCAACGAGGGCGTGGTGGAGGCGTCGCGGGAGCTAAGGGCGGCGCTGGCGGCTCTCGACTCGGCCATGGGCTCG
CGAGCGCCACGCTACATGGTGCCGGCGGCGTGTCTGACGCTGGGCCGCATGCCGTCGCTGGTGTCGGGCAAGACG
GACCGCAGGCGGCTGCGCGAGATTGGCGAGGCCATTTGTCGCTCGAGGCTGCTGGAGGGGGGGCATGAGGGGCAC
GAGGGGCAAGAGGAAGAGGAGGCGCAGACGGAAAAGGAAAAGCTGCTGGTGCAGGCGTGGACGCAGGTGCTGGGC
AACGACAAGAGGGGCCTCTTTCGGCAGTCCAACTTTTTTGCGCTGGGCGGCGACTCGCTGCGGGCCATGAAGCTC
GTGTCGGCGGCGCGACGGCTCGGTCTGTCGCTCAGCGTGGGCGAGGTGTTTACGACGCCCACTCTGGCGGGCATG
GCGCAAGCATCGAGCACAGCAGCAGCAGGCGCAGACGAGGACGACATTGCGCCCTTTTCGCTCCTGGCCAAGGAC
TGGCCGGCCGACGAGGCGCGGCAACAGACGGCGGCGCTGTGCGGGCTCCCGAGCGACGCGGTTCAAGACGTCTAT
GCCTGCACGCCGCTGCAAGAGGCGCTCATGGCTCTGTCGGCAAAGGTGGCCGAGGCATACGTGGCGCAGCGCCTT
GTTGAGCTTTGCGACGCGGCCACGGCTGAGCGGCTCGGCGCAGCGGTGCAGCAGGCACAGCGCCAGTCGAGCATC
CTGCGCACGCGCATCGTCCAGGTGCCCGGGCGTGGCCTGTTCCAGGTGGTGGTGGGCGCAGCCTGGGCGTGGCAT
CTCGACTCGGGGCGCAGCCTCGACGACTACCTGGCGACGGACCGCGCGCGACGCATGGAGCTCGGGCAGCCGCTG
GCGCGCTTTGCCGTGGTGCAGGGAGCGCGGCCCAGCTTTGTGGTGACGATGCACCACTCGCTCTATGACGGGTGG
TGCATGCCGCTCATTGTCGACAGCATCAACCGCGCCTTTGTGCATGGGCAGCCGCGGGTGCGCGCAGCCGACATG
AGGCACTTTATGCGCTACCTGGCGTCGCGCGACCAGGCCGCGTCGCAAGACTTTTGGCGGCGCCGGCTCCAGGGC
GCCACGGGGCTGCAGTTCCCCCTGCTGCCCTGGCACGGATACCAGCCGCGCGCCGACTCGCTGCTCGAGGAGTAT
GTGGCACTGGATGCTGGCGGCGGCGCCACCACGCTGGCCGCCACCATTCGCGCAGCCTGGACCCTGGTGGCTGCG
CGCTACACGGCCAACCCTCATGTCGTCTTTGGCGAGACGCTGACGGGCCGCAACGCGCCCATTGCCGCCGCCGAC
GAGATTGAGGGCCCCCTCATCACCACGGTGCCCGTCCATGTCGTGGTGGATGCCGAGGCGTCCCTCGATGCCTTT
GTGCACGCTCTGCAGCGTCAGACGGTGGCCCAGATGGCCCACGAGCACATGGGCCTGCAAAACATTCGCCGCCTC
AGCTCCGACGCCCGCGAGGCCTGCCAGCTGGGCACCGGCCTTGTCCTGCAGCCGAGCACGCACCGCGCCGCGCCG
GATGCTCTGCCCGCCAGCCGCCTGGTGCCCGCCAGCGACGACGAGGCGGCGCGCGAGGCCCTCAAGTTTAACACG
TATGCCGTGATGCTTGTGTGCTCCATGGATGCCCACGGCTTCCTCGTCATGGCCAGCTTTGACGCCAAGACGGTG
CATGCCGACTTGATGCAGCGCGTTCTTGGCCAGCTCAAGACGGTGGCGCGCCTTGTCCACAGCGGCCGTTGTGGC
AGCATGCGCGTTGGCGACGTGGTGCGTGCTACCGCTGCCGACTTGACCCTGCTAGAGGCTTATGCCGCGGCTCCT
CGTGCCCATGGCCTCGCCTGTGTGCCACGCCAGGGCGTCGAGGCGCTTCATGTAGTCGACCCGGCCGACGCGAGC
GTGCTGCAGCCAGTGGGAGCCGTGGGAGAGCTGGTGGTGCAGGCCGCCAACCCCCTACCGCTAACGGAGCTGGCA
AGGCGGCCCAGCTGGCTCAAGGCTAGCAGCAGTAGTAGTGACTCGCGCCTCTTTTGCACCGGGCAGCTGGTGCGC
TACAATGGCGAGGGCCGTCTGCAGCCTGTTGAGCATGCACAAGAGCAGCAGCCAGCGCCGTCGTCACAGCGCCTA
TCAGCGGCATCGCACAAGCAGCGTCGCCTAGGCCGGCTATGGAGCCGGGTGCTGGACATTGCGCAAGACGACATT
GGCCTCGACGACAGCTTCTTCTTGCTGGGCGGCGACTCCATCAGCGCCATGAAGCTGGTGGCGGAGGCGCGGCTC
GAGGGGATTGGGCTGACGGTGATGCAAATCTTTGAGACGCGGCGCCTCTTTGACATGGCGCAGGCGATGCAGGAG
CAGCAGCAGCAGCACGACGAGGCGGCGCAGCACGACGAGGCGGTGGGTTTATCGCTGCTCGCCGTGGACGACGCA
GACGCCTTTGTGCGCGACGTGGTGCAGCCGCAGCTGCTCGAGCCGGGCATCACCATTGAGCACGTCTTGCCGGCG
CGGCCGCTGCAGCACGTGGCGGTGCAGGGCACGGTGCAGGAGCCACGCTTTGCCGTGCGCTACGAGCTCATGTTT
TTCGACGCGCCCGTGGATGCGGCACGTCTGGCGCGGGCCTGCCAGGCGCTGGTGGACGCGCACGAGATTCTGCGC
ACCCTCTTTGTCCAGCACGAGGCGCAGTGTCTGGCCGTGGCCACGAGGGGCCTGCGCGTGCGCTTCGAGGAGCAC
TGCGTCGACTGCGATGCCCAGCTTGACGAGTATGCGCGCCATTGGTGTCGCCTCAATGTGCGCTCCAGCATGCCT
CATGGCTCGGCCTTTGTGGCCTGGCTGCTGGTGCGTGCGCGTCTCGGTCGTCGCGCCTGTCTGGTCTGGCGCATC
TCGCATGCGCAGTATGATGAGCTGTGTCTGCCCGTCATGCTGCGCCACCTCTCGGCCCTCTACCAAGGCGATGAC
GATGCTGCTGCTCGAGCTGCCATCCCCCCAGCCACGCCCTTTTCCAGCTATGTTGCCCACGTCTTGCGCCACGCC
ATCCCTGCCAGCACGCCCTACTGGCGCCGTCTCCTGGCCGGCTCATCTCTCTCCATTCTCCGGCCCCCCGAACCA
GTCACCCGCACCGCCCACTTTGCCATTCAAACCACGCTCGACATCTCGTCTTGTCCGCTCGACGTCACGCCCGCC
ACCCTCCCCACCGCCTCTTGGGCCCTCTGCCTCGCCCGCCGCCTGGCCACCCGCGACGTCGTCTTTGGCGAAGTC
GTTTCCGGCCGCAACATTTCCTCTCCATCTCCCCACGCCGTCGTTGGTCCTTGCTGGCAATATATCCCCGTCCGC
GTATGCTTCCAGCCAACATGGCGTGCTTGCGATTTGCTCGCCCACGTGCAGCGCCAACACGTCGCCTCTGCCGCC
CACGAAGCCATGGCCTTTGCAGAAATCGTAAGCCGCTGCACAGACTGGGATGCAGAGTCGACGCCCCGGTGGTTC
GACTCGGTGGTGCATCAAGATGTCGCCCACGTCACCTCTTTACCATTTGCCGCGTGTGAGCGCATGGAGACGCTG
TATCCCCACCAAGAGCCGCTGGATGAGTGGAAGATTCAGGCCTATATTGATGCAGGTGCAATGACGCTGGAAATT
GTCACGGTGGAGAGCTGGGGGGAGTATGCAAAGGGCTTGCTGGACGATTTGGCAGCCGCCGTGCGCGTCTTGCTT
GATAATGGAGCCGCCCCGCTTTGTCTAGATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail