Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2522
Gene name
LocationContig_18:164345..165417
Strand-
Gene length (bp)1072
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 6.0E-39 35 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08235|BRX1_YEAST Ribosome biogenesis protein BRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRX1 PE=1 SV=2 1 286 2.0E-114
sp|Q9HGL6|BRX1_SCHPO Ribosome biogenesis protein brx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brx1 PE=3 SV=1 1 289 2.0E-104
sp|Q8UVY2|BRX1_XENLA Ribosome biogenesis protein BRX1 homolog OS=Xenopus laevis GN=brix1 PE=2 SV=1 22 292 3.0E-84
sp|Q3SZZ0|BRX1_BOVIN Ribosome biogenesis protein BRX1 homolog OS=Bos taurus GN=BRIX1 PE=2 SV=1 22 290 5.0E-82
sp|Q8TDN6|BRX1_HUMAN Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens GN=BRIX1 PE=1 SV=2 22 290 8.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08235|BRX1_YEAST Ribosome biogenesis protein BRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRX1 PE=1 SV=2 1 286 2.0E-114
sp|Q9HGL6|BRX1_SCHPO Ribosome biogenesis protein brx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brx1 PE=3 SV=1 1 289 2.0E-104
sp|Q8UVY2|BRX1_XENLA Ribosome biogenesis protein BRX1 homolog OS=Xenopus laevis GN=brix1 PE=2 SV=1 22 292 3.0E-84
sp|Q3SZZ0|BRX1_BOVIN Ribosome biogenesis protein BRX1 homolog OS=Bos taurus GN=BRIX1 PE=2 SV=1 22 290 5.0E-82
sp|Q8TDN6|BRX1_HUMAN Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens GN=BRIX1 PE=1 SV=2 22 290 8.0E-82
sp|Q9DCA5|BRX1_MOUSE Ribosome biogenesis protein BRX1 homolog OS=Mus musculus GN=Brix1 PE=1 SV=3 2 290 8.0E-82
sp|Q5RAN2|BRX1_PONAB Ribosome biogenesis protein BRX1 homolog OS=Pongo abelii GN=BRIX1 PE=2 SV=1 22 290 2.0E-80
sp|Q4QQT6|BRX1_RAT Ribosome biogenesis protein BRX1 homolog OS=Rattus norvegicus GN=Brix1 PE=2 SV=1 22 292 2.0E-80
sp|Q9VZE6|BRX1_DROME Ribosome biogenesis protein BRX1 homolog OS=Drosophila melanogaster GN=CG11583 PE=2 SV=2 26 284 1.0E-72
sp|Q54JN0|BRX1_DICDI Ribosome biogenesis protein BRX1 homolog OS=Dictyostelium discoideum GN=bxdc2 PE=3 SV=1 27 279 4.0E-72
sp|P34524|BRX1_CAEEL Ribosome biogenesis protein BRX1 homolog OS=Caenorhabditis elegans GN=K12H4.3 PE=3 SV=1 26 274 7.0E-72
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0006364 rRNA processing Yes
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003723 RNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:1901363 heterocyclic compound binding No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2522
MAAVYKSLSKGSSQKTEEPIVGAKKNKQRVLILSSRGVTYRHRHLLNDIASMMPHGRKDAKFDSKSKLGELNELA
ELYNCNNVLFFEARKGKDLYVWLSKVPNGPTVKMHLQNLHTMEELHFTGNCLKGSRPILSFDAAFDKQPHLRVIK
ELFLHTFGVPQGARKSKPFIDHVMGFSVADGKIWVRNYQISEEESLVVKPGSEDAADSAQKKTDSKSRKGSGDTE
VKLVEIGPRFVLTPIVIQEGSFGGPIIYENREFISPNQLRSDLRRSKASRHDARTEKTVSRLSRKADLGLRSATY
RQRGSKSELDNRVLFS*
Coding >OphauB2|2522
ATGGCTGCCGTCTACAAGTCCCTGTCAAAGGGCAGCTCACAAAAAACTGAGGAACCTATCGTTGGCGCCAAGAAG
AACAAGCAAAGAGTGCTGATCCTTTCGTCGAGAGGTGTTACCTACAGGCATCGACACCTCTTGAATGACATTGCG
TCTATGATGCCACATGGTCGGAAAGATGCCAAATTTGACTCCAAATCGAAGCTTGGCGAATTGAACGAATTGGCT
GAGCTCTACAACTGCAACAACGTCTTATTCTTTGAGGCAAGGAAGGGAAAAGATCTCTACGTTTGGCTTAGCAAA
GTGCCCAATGGACCGACGGTCAAGATGCATCTCCAAAACCTTCACACAATGGAAGAGCTTCATTTTACAGGCAAT
TGTCTCAAAGGCTCCAGGCCGATCCTTTCGTTCGATGCCGCCTTTGATAAACAGCCCCACCTCCGCGTCATCAAG
GAACTCTTCCTGCATACCTTTGGAGTGCCTCAAGGAGCACGAAAGTCGAAACCATTCATCGATCACGTCATGGGC
TTCAGCGTGGCTGATGGTAAAATTTGGGTACGGAATTACCAGATTAGCGAGGAAGAAAGCTTGGTAGTCAAGCCA
GGATCTGAGGATGCCGCAGATAGCGCACAGAAGAAGACCGATTCCAAGTCTAGAAAAGGAAGTGGTGACACAGAG
GTCAAACTCGTCGAGATTGGGCCGCGGTTTGTCCTCACTCCGATAGTGATTCAGGAAGGTTCATTTGGTGGTCCA
ATCATCTATGAGAACCGCGAATTTATATCGCCAAATCAGCTAAGGTCGGATCTGCGCCGATCAAAGGCCTCGAGA
CATGACGCCAGGACGGAAAAGACGGTATCAAGGTTGTCTAGAAAGGCAGACTTGGGACTGAGATCCGCTACCTAC
CGCCAACGGGGATCCAAGAGCGAGCTCGACAATCGGGTTCTGTTTTCATAA
Transcript >OphauB2|2522
ATGGCTGCCGTCTACAAGTCCCTGTCAAAGGGCAGCTCACAAAAAACTGAGGAACCTATCGTTGGCGCCAAGAAG
AACAAGCAAAGAGTGCTGATCCTTTCGTCGAGAGGTGTTACCTACAGGCATCGACACCTCTTGAATGACATTGCG
TCTATGATGCCACATGGTCGGAAAGATGCCAAATTTGACTCCAAATCGAAGCTTGGCGAATTGAACGAATTGGCT
GAGCTCTACAACTGCAACAACGTCTTATTCTTTGAGGCAAGGAAGGGAAAAGATCTCTACGTTTGGCTTAGCAAA
GTGCCCAATGGACCGACGGTCAAGATGCATCTCCAAAACCTTCACACAATGGAAGAGCTTCATTTTACAGGCAAT
TGTCTCAAAGGCTCCAGGCCGATCCTTTCGTTCGATGCCGCCTTTGATAAACAGCCCCACCTCCGCGTCATCAAG
GAACTCTTCCTGCATACCTTTGGAGTGCCTCAAGGAGCACGAAAGTCGAAACCATTCATCGATCACGTCATGGGC
TTCAGCGTGGCTGATGGTAAAATTTGGGTACGGAATTACCAGATTAGCGAGGAAGAAAGCTTGGTAGTCAAGCCA
GGATCTGAGGATGCCGCAGATAGCGCACAGAAGAAGACCGATTCCAAGTCTAGAAAAGGAAGTGGTGACACAGAG
GTCAAACTCGTCGAGATTGGGCCGCGGTTTGTCCTCACTCCGATAGTGATTCAGGAAGGTTCATTTGGTGGTCCA
ATCATCTATGAGAACCGCGAATTTATATCGCCAAATCAGCTAAGGTCGGATCTGCGCCGATCAAAGGCCTCGAGA
CATGACGCCAGGACGGAAAAGACGGTATCAAGGTTGTCTAGAAAGGCAGACTTGGGACTGAGATCCGCTACCTAC
CGCCAACGGGGATCCAAGAGCGAGCTCGACAATCGGGTTCTGTTTTCATAA
Gene >OphauB2|2522
ATGGCTGCCGTCTACAAGTCCCTGTCAAAGGGCAGCTCACAAAAAACTGAGGAACCTATCGTTGGCGCCAAGAAG
AACAAGCAAAGAGTGCTGATCCTTTCGTCGAGAGGTGTTACCTACAGGTCAGTCATGGGACATACAGATATTCTT
CTTTTGCGGCCCAAGTATTTGCTAACATGGCCCATCAATTCCAGGCATCGACACCTCTTGAATGACATTGCGTCT
ATGATGCCACATGGTCGGAAAGATGCCAAATTTGACTCCAAATCGAAGCTTGGCGAATTGAACGAATTGGCTGAG
CTCTACAACTGCAACAACGTCTTATTCTTTGAGGCAAGGAAGGGAAAAGATCTCTACGTTTGGCTTAGCAAAGTG
CCCAATGGACCGACGGTCAAGATGCATCTCCAAAACCGTAAGCGACATGTTCTTGCCATCTTGCTAGTTTCTGAC
GATATCTGCAGTTCACACAATGGAAGAGCTTCATTTTACAGGCAATTGTCTCAAAGGCTCCAGGCCGATCCTTTC
GTTCGATGCCGCCTTTGATAAACAGCCCCACCTCCGCGTCATCAAGGAACTCTTCCTGCATACCTTTGGAGTGCC
TCAAGGAGCACGAAAGTCGAAACCATTCATCGATCACGTCATGGGCTTCAGCGTGGCTGATGGTAAAATTTGGGT
ACGGAATTACCAGATTAGCGAGGAAGAAAGCTTGGTAGTCAAGCCAGGATCTGAGGATGCCGCAGATAGCGCACA
GAAGAAGACCGATTCCAAGTCTAGAAAAGGAAGTGGTGACACAGAGGTCAAACTCGTCGAGATTGGGCCGCGGTT
TGTCCTCACTCCGATAGTGATTCAGGAAGGTTCATTTGGTGGTCCAATCATCTATGAGAACCGCGAATTTATATC
GCCAAATCAGCTAAGGTCGGATCTGCGCCGATCAAAGGCCTCGAGACATGACGCCAGGACGGAAAAGACGGTATC
AAGGTTGTCTAGAAAGGCAGACTTGGGACTGAGATCCGCTACCTACCGCCAACGGGGATCCAAGAGCGAGCTCGA
CAATCGGGTTCTGTTTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail