Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2517
Gene name
LocationContig_18:149549..151966
Strand-
Gene length (bp)2417
Transcript length (bp)2286
Coding sequence length (bp)2286
Protein length (aa) 762

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09733 VEFS-Box VEFS-Box of polycomb protein 1.6E-05 569 633

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2448
Ophiocordyceps australis map64 (Brazil) OphauB2|2517 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04297
Ophiocordyceps camponoti-rufipedis Ophun1|2114
Ophiocordyceps kimflemingae Ophio5|1392
Ophiocordyceps subramaniannii Hirsu2|2172

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2517
MSMTAQSPCQPSAPYLHRTWLKSVKSHDDSTPQSLVMGGALSSPLNANRQPHGLASAVGMAMGIGVGDGALEHDA
RPVKRRRLSSAAIDDDASRPSAWSSLRIDVLKLLHKDSKKVKSSQSALTQPRGSVFTKGCCRITIFDVSSGSPRL
LHCQSQLCNLLTAKNPVGPHHLARIDLPSPFHIPRDSLLINRLDDGRFDLSDSYQLLVELEAAMGSPWPPLEPLD
LGISSQAVQQASPASLRNWLLSSRFDSVFGRLRNPLQLSSTAPSDALNHQTSYVMDVDLRWASGFNSLRAHDEDP
KSCITALDPDEVSRGTALMAQPRLVNGVDLATEGFTNGEASHIHDDDSVGEHTPSRSLRAREKPTVYNLKQLSDQ
AQGREHRRRARSASLVANDGRIQYLLPPEQPISLDCYRCITCGVYHESMSQLQLHLQTMHSNFDYVLETAGQVPQ
FRVSVIRDLLTTPNKTLQLSRPVKPFNLYSAAAGDQSWITSRYIVDADYLPQSPSVKARSEQPRSTSPAAKGARP
AVLRRGPKLKNRKIVVPSIAQPLFHPISKARLAPGQEVPEVVPDDEWLIHKHRECIGDFSDVTAAEKEFIWEWDD
YILRRNITSGAYFPRVWLSFVRDKSAWLVAEEQRMLEFGKHVSVLLARDALDEAALKRALSYINSAREELRRLPQ
ARTAGAGSQGTPSAPKLSPRSAQIRKSTNGCAVCQLPVRGPTLLICSNTDCPRRLYHSTCVCTKAMMPVTQSPWL
CDSCCQDVTHS*
Coding >OphauB2|2517
ATGAGTATGACGGCTCAAAGTCCCTGCCAGCCAAGTGCTCCCTATCTTCACCGCACCTGGCTCAAGAGTGTCAAG
TCTCATGACGATTCCACTCCCCAGTCGCTAGTCATGGGAGGCGCGCTGTCGTCGCCTCTGAATGCTAACCGCCAG
CCTCATGGCTTGGCCTCGGCCGTTGGCATGGCCATGGGCATTGGGGTTGGCGACGGCGCCCTGGAACATGACGCT
CGCCCTGTCAAGCGCCGCCGCCTCTCTTCTGCTGCCATTGACGACGACGCCTCTCGTCCCTCAGCTTGGTCCTCA
TTGCGCATTGACGTGCTCAAGTTGCTGCACAAGGATTCCAAAAAGGTCAAGTCGTCGCAATCCGCCCTGACGCAG
CCTCGCGGTTCAGTTTTCACAAAGGGCTGTTGCCGCATCACCATTTTTGATGTCAGCTCTGGCTCGCCGCGTCTT
CTTCACTGTCAGAGCCAGCTATGCAATCTCTTGACGGCAAAGAATCCCGTGGGCCCTCATCACCTTGCTCGAATC
GACCTCCCCTCGCCATTTCATATCCCCCGCGATTCACTGCTAATCAACCGTCTCGACGATGGCAGGTTTGATTTA
TCCGACTCGTACCAGCTTCTTGTCGAGCTTGAAGCTGCCATGGGCTCACCTTGGCCTCCTCTTGAGCCACTGGAT
CTCGGCATTTCCTCCCAAGCTGTCCAGCAGGCCTCTCCCGCTTCTCTCAGGAACTGGCTTCTTTCTAGTCGCTTT
GATAGCGTATTTGGTCGGCTTCGAAATCCGCTCCAGCTGTCGAGCACGGCGCCTTCAGATGCGCTGAACCACCAG
ACGTCGTATGTCATGGATGTTGATCTCCGGTGGGCCTCGGGATTCAACTCATTACGGGCTCACGATGAAGACCCC
AAGTCTTGCATCACAGCTCTCGATCCCGACGAAGTTTCTCGCGGCACCGCTCTCATGGCTCAGCCCAGACTGGTC
AATGGGGTCGACTTGGCCACCGAGGGCTTTACCAATGGCGAAGCGTCTCATATCCATGATGATGATTCTGTTGGA
GAGCACACGCCCTCTCGATCTCTTAGGGCTCGCGAGAAGCCGACTGTGTACAATCTCAAACAGCTGAGCGACCAA
GCACAGGGCCGAGAGCACAGGAGACGCGCAAGGAGCGCCAGCCTGGTAGCAAACGATGGGAGGATTCAGTACCTC
TTGCCTCCCGAGCAGCCCATTTCTCTAGACTGCTACCGCTGCATCACGTGTGGCGTCTACCACGAGTCCATGTCA
CAACTGCAACTTCATTTGCAGACGATGCACTCGAATTTTGATTACGTGCTCGAGACAGCAGGCCAAGTGCCCCAG
TTCCGCGTCTCCGTCATTCGCGACTTGTTGACGACTCCTAACAAGACACTGCAGCTGTCGCGCCCCGTCAAGCCC
TTTAATCTCTACTCTGCCGCGGCTGGCGATCAGTCGTGGATCACGTCGCGGTATATTGTTGACGCGGACTATCTG
CCTCAATCTCCTTCGGTCAAGGCGCGCAGTGAGCAGCCGCGGTCAACGTCTCCGGCTGCCAAGGGCGCAAGGCCT
GCCGTGCTGCGTCGCGGGCCCAAGCTCAAGAATCGCAAGATTGTGGTGCCATCGATTGCTCAGCCTCTCTTTCAT
CCCATTAGCAAGGCGCGGCTTGCGCCTGGACAGGAAGTGCCCGAGGTTGTGCCCGATGACGAGTGGCTCATTCAC
AAGCACCGGGAATGCATTGGAGACTTTTCCGACGTGACAGCCGCCGAGAAGGAGTTTATCTGGGAATGGGACGAC
TACATTTTGCGCAGAAACATCACGTCGGGGGCATATTTTCCACGAGTCTGGCTCAGCTTTGTCAGAGACAAGTCG
GCATGGCTGGTGGCTGAGGAGCAGCGCATGCTCGAGTTTGGCAAGCATGTCAGCGTGCTGCTGGCCCGTGATGCG
CTCGACGAGGCGGCCCTGAAGCGAGCCCTTTCGTATATCAATAGCGCAAGAGAAGAGCTGAGGCGACTGCCCCAA
GCAAGGACGGCTGGTGCCGGCTCGCAGGGCACCCCCTCTGCGCCCAAACTGTCTCCGCGATCGGCCCAGATTCGG
AAAAGCACCAATGGCTGCGCCGTGTGTCAATTGCCTGTCCGAGGCCCAACGCTACTAATTTGCTCCAATACGGAC
TGCCCGCGGCGCCTCTATCATTCGACTTGTGTCTGCACCAAGGCCATGATGCCCGTTACTCAATCTCCCTGGCTC
TGCGATTCCTGTTGCCAAGACGTGACGCATAGCTAG
Transcript >OphauB2|2517
ATGAGTATGACGGCTCAAAGTCCCTGCCAGCCAAGTGCTCCCTATCTTCACCGCACCTGGCTCAAGAGTGTCAAG
TCTCATGACGATTCCACTCCCCAGTCGCTAGTCATGGGAGGCGCGCTGTCGTCGCCTCTGAATGCTAACCGCCAG
CCTCATGGCTTGGCCTCGGCCGTTGGCATGGCCATGGGCATTGGGGTTGGCGACGGCGCCCTGGAACATGACGCT
CGCCCTGTCAAGCGCCGCCGCCTCTCTTCTGCTGCCATTGACGACGACGCCTCTCGTCCCTCAGCTTGGTCCTCA
TTGCGCATTGACGTGCTCAAGTTGCTGCACAAGGATTCCAAAAAGGTCAAGTCGTCGCAATCCGCCCTGACGCAG
CCTCGCGGTTCAGTTTTCACAAAGGGCTGTTGCCGCATCACCATTTTTGATGTCAGCTCTGGCTCGCCGCGTCTT
CTTCACTGTCAGAGCCAGCTATGCAATCTCTTGACGGCAAAGAATCCCGTGGGCCCTCATCACCTTGCTCGAATC
GACCTCCCCTCGCCATTTCATATCCCCCGCGATTCACTGCTAATCAACCGTCTCGACGATGGCAGGTTTGATTTA
TCCGACTCGTACCAGCTTCTTGTCGAGCTTGAAGCTGCCATGGGCTCACCTTGGCCTCCTCTTGAGCCACTGGAT
CTCGGCATTTCCTCCCAAGCTGTCCAGCAGGCCTCTCCCGCTTCTCTCAGGAACTGGCTTCTTTCTAGTCGCTTT
GATAGCGTATTTGGTCGGCTTCGAAATCCGCTCCAGCTGTCGAGCACGGCGCCTTCAGATGCGCTGAACCACCAG
ACGTCGTATGTCATGGATGTTGATCTCCGGTGGGCCTCGGGATTCAACTCATTACGGGCTCACGATGAAGACCCC
AAGTCTTGCATCACAGCTCTCGATCCCGACGAAGTTTCTCGCGGCACCGCTCTCATGGCTCAGCCCAGACTGGTC
AATGGGGTCGACTTGGCCACCGAGGGCTTTACCAATGGCGAAGCGTCTCATATCCATGATGATGATTCTGTTGGA
GAGCACACGCCCTCTCGATCTCTTAGGGCTCGCGAGAAGCCGACTGTGTACAATCTCAAACAGCTGAGCGACCAA
GCACAGGGCCGAGAGCACAGGAGACGCGCAAGGAGCGCCAGCCTGGTAGCAAACGATGGGAGGATTCAGTACCTC
TTGCCTCCCGAGCAGCCCATTTCTCTAGACTGCTACCGCTGCATCACGTGTGGCGTCTACCACGAGTCCATGTCA
CAACTGCAACTTCATTTGCAGACGATGCACTCGAATTTTGATTACGTGCTCGAGACAGCAGGCCAAGTGCCCCAG
TTCCGCGTCTCCGTCATTCGCGACTTGTTGACGACTCCTAACAAGACACTGCAGCTGTCGCGCCCCGTCAAGCCC
TTTAATCTCTACTCTGCCGCGGCTGGCGATCAGTCGTGGATCACGTCGCGGTATATTGTTGACGCGGACTATCTG
CCTCAATCTCCTTCGGTCAAGGCGCGCAGTGAGCAGCCGCGGTCAACGTCTCCGGCTGCCAAGGGCGCAAGGCCT
GCCGTGCTGCGTCGCGGGCCCAAGCTCAAGAATCGCAAGATTGTGGTGCCATCGATTGCTCAGCCTCTCTTTCAT
CCCATTAGCAAGGCGCGGCTTGCGCCTGGACAGGAAGTGCCCGAGGTTGTGCCCGATGACGAGTGGCTCATTCAC
AAGCACCGGGAATGCATTGGAGACTTTTCCGACGTGACAGCCGCCGAGAAGGAGTTTATCTGGGAATGGGACGAC
TACATTTTGCGCAGAAACATCACGTCGGGGGCATATTTTCCACGAGTCTGGCTCAGCTTTGTCAGAGACAAGTCG
GCATGGCTGGTGGCTGAGGAGCAGCGCATGCTCGAGTTTGGCAAGCATGTCAGCGTGCTGCTGGCCCGTGATGCG
CTCGACGAGGCGGCCCTGAAGCGAGCCCTTTCGTATATCAATAGCGCAAGAGAAGAGCTGAGGCGACTGCCCCAA
GCAAGGACGGCTGGTGCCGGCTCGCAGGGCACCCCCTCTGCGCCCAAACTGTCTCCGCGATCGGCCCAGATTCGG
AAAAGCACCAATGGCTGCGCCGTGTGTCAATTGCCTGTCCGAGGCCCAACGCTACTAATTTGCTCCAATACGGAC
TGCCCGCGGCGCCTCTATCATTCGACTTGTGTCTGCACCAAGGCCATGATGCCCGTTACTCAATCTCCCTGGCTC
TGCGATTCCTGTTGCCAAGACGTGACGCATAGCTAG
Gene >OphauB2|2517
ATGAGTATGACGGCTCAAAGTCCCTGCCAGCCAAGTGCTCCCTATCTTCACCGCACCTGGCTCAAGAGTGTCAAG
TCTCATGACGATTCCACTCCCCAGTCGCTAGTCATGGGAGGCGCGCTGTCGTCGCCTCTGAATGCTAACCGCCAG
CCTCATGGCTTGGCCTCGGCCGTTGGCATGGCCATGGGCATTGGGGTTGGCGACGGCGCCCTGGAACATGACGCT
CGCCCTGTCAAGCGCCGCCGCCTCTCTTCTGCTGCCATTGACGACGACGCCTCTCGTCCCTCAGCTTGGTCCTCA
TTGCGCATTGACGTGCTCAAGTTGCTGCACAAGGATTCCAAAAAGGTCAAGTCGTCGCAATCCGCCCTGACGCAG
CCTCGCGGTTCAGTTTTCACAAAGGGCTGTTGCCGCATCACCATTTTTGATGTCAGCTCTGGCTCGCCGCGTCTT
CTTCACTGTCAGAGCCAGCTATGCAATCTCTTGACGGCAAAGAATCCCGTGGGCCCTCATCACCTTGCTCGAATC
GACCTCCCCTCGCCATTTCATATCCCCCGCGATTCACTGCTAATCAACCGTCTCGACGATGGCAGGTTTGATTTA
TCCGACTCGTACCAGCTTCTTGTCGAGCTTGAAGCTGCCATGGGCTCACCTTGGCCTCCTCTTGAGCCACTGGAT
CTCGGCATTTCCTCCCAAGCTGTCCAGCAGGCCTCTCCCGCTTCTCTCAGGAACTGGCTTCTTTCTAGTCGCTTT
GATAGCGTATTTGGTCGGCTTCGAAATCCGCTCCAGCTGTCGAGCACGGCGCCTTCAGATGCGCTGAACCACCAG
ACGTCGTATGTCATGGATGTTGATCTCCGGTGGGCCTCGGGATTCAACTCATTACGGGCTCACGATGAAGACCCC
AAGTCTTGCATCACAGCTCTCGATCCCGACGAAGTTTCTCGCGGCACCGCTCTCATGGCTCAGCCCAGACTGGTC
AATGGGGTCGACTTGGCCACCGAGGGCTTTACCAATGGCGAAGCGTCTCATATCCATGATGATGATTCTGTTGGA
GAGCACACGCCCTCTCGATCTCTTAGGGCTCGCGAGAAGCCGACTGTGTACAATCTCAAACAGCTGAGCGACCAA
GCACAGGGCCGAGAGCACAGGAGACGCGCAAGGAGCGCCAGCCTGGTAGCAAACGATGGGAGGATTCAGTACCTC
TTGCCTCCCGAGCAGCCCATTTCTCTAGACTGCTACCGCTGCATCACGTGTGGCGTCTACCACGAGTCCATGTCA
CAACTGCAACTTCATTTGCAGACGATGCACTCGAATTTTGATTACGTGCTCGAGACAGCAGGCCAAGTGCCCCAG
TTCCGCGTCTCCGTCATTCGCGACTTGTTGACGACTCCTAACAAGACACTGCAGCTGTCGCGCCCCGTCAAGCCC
TTTAATCTCTACTCTGCCGCGGCTGGCGATCAGTCGTGGATCACGTCGCGGTATATTGTTGACGCGGACTATCTG
CCTCAATCTCCTTCGGTCAAGGCGCGCAGTGAGCAGCCGCGGTCAACGTCTCCGGCTGCCAAGGGCGCAAGGCCT
GCCGTGCTGCGTCGCGGGCCCAAGCTCAAGAATCGCAAGATTGTGGTGCCATCGATTGCTCAGCCTCTCTTTCAT
CCCATTAGCAAGGCGCGGCTTGCGCCTGGACAGGAAGTGCCCGAGGTTGTGCCCGATGACGAGTGGCTCATTCAC
AAGCACCGGGAATGCATTGGAGACTTTTCCGACGTGACAGCCGCCGAGAAGGAGTTTATCTGGGAATGGGACGAC
TACATTTTGCGCAGAAACATCACGTCGGGGGCATATTTTCCACGAGTCTGGCTCAGCTTTGTCAGAGACAAGTCG
GCATGGCTGGTGGCTGAGGAGCAGCGCATGCTCGAGTTTGGCAAGCATGTCAGCGTGCTGCTGGCCCGTGATGCG
CTCGACGAGGCGGCCCTGAAGCGAGCCCTTTCGTATATCAATAGCGCAAGAGAAGAGCTGAGGCGACTGCCCCAA
GCAAGGACGGCTGGTGCCGGCTCGCAGGGCACCCCCTCTGCGCCCAAACTGTCTCCGCGATCGGCCCAGATTCGG
AAAAGCACCAATGGCTGCGCCGTGTGTCAATTGCCTGTCCGAGGCCCAACGCTACTAATTTGCTCCAATACGGTT
TGTTTGTCCCCATGCTTTGATTGCCTGCTACTTGTTTCTTTGTACCCACCAGAGTGGTGTGTTTTGTTTGATTGG
CACCTTGTATCCCCTCCGTGTGCAACCAGTGGCGCTGACTGCAACTGTCGCAGGACTGCCCGCGGCGCCTCTATC
ATTCGACTTGTGTCTGCACCAAGGCCATGATGCCCGTTACTCAATCTCCCTGGCTCTGCGATTCCTGTTGCCAAG
ACGTGACGCATAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail