Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2514
Gene name
LocationContig_18:142482..144066
Strand+
Gene length (bp)1584
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14630 ORC5_C Origin recognition complex (ORC) subunit 5 C-terminus 2.3E-65 198 451
PF13191 AAA_16 AAA ATPase domain 1.9E-10 24 174

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43114|ORC5_SCHPO Origin recognition complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orc5 PE=1 SV=2 23 445 2.0E-23
sp|Q9WUV0|ORC5_MOUSE Origin recognition complex subunit 5 OS=Mus musculus GN=Orc5 PE=2 SV=1 26 458 2.0E-22
sp|Q24169|ORC5_DROME Origin recognition complex subunit 5 OS=Drosophila melanogaster GN=Orc5 PE=1 SV=1 24 457 5.0E-20
sp|O43913|ORC5_HUMAN Origin recognition complex subunit 5 OS=Homo sapiens GN=ORC5 PE=1 SV=1 26 406 1.0E-18

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0005634 nucleus Yes
GO:0000808 origin recognition complex Yes
GO:0043227 membrane-bounded organelle No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0043231 intracellular membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2514
MSANDDDGFALPDETVLAPVLHNFPARERQIRWLATLVYPEAAPVANLVLHGTEATGKSAMTAQLLPCLAASSPT
GFGHAIINVAQCVSARQLFERIVDAVARAMGEAEGQLARRLARCETLAQLAVALETLLVSPRRSRWRFVLVLDGI
DRQRDGPPVLVPALARLSETIDRLACIFIVTAPAAGLLRLPAAQYLGFPPYSKADYVRIMALTPPRQLAQTTVAD
TSHLWTRFCATVHDALIRPASRTLPALRHACRVLWPRFTAPVARGELGPNDFSRLLVAARPLLQDESLLCPAIIS
YRPLAQEAASTTLSLAANTPPARDGPLRLLPMAARLLLLSAYLASHNAVRHDLVVFSTQHHRRRRRRAPAAASSR
PGSVKHRRIARKLLGAHAFVLERMLAIFEAVRLEWTPDACSLAAAGLDADVAAALATLASLRLLVRVGAGDVMDR
RSIGVELDEWLIES*
Coding >OphauB2|2514
ATGAGCGCCAACGACGACGACGGCTTTGCCTTGCCAGACGAGACGGTACTGGCGCCTGTACTGCACAATTTTCCT
GCACGCGAGCGGCAGATTCGCTGGCTGGCTACTCTAGTCTATCCCGAGGCGGCGCCAGTGGCCAATCTTGTGCTG
CATGGCACCGAGGCCACGGGCAAGTCGGCCATGACGGCGCAGCTGCTGCCGTGTCTGGCGGCCAGTTCCCCGACG
GGCTTTGGGCATGCAATAATCAATGTGGCACAGTGCGTATCGGCGCGTCAGCTGTTTGAGCGCATTGTGGATGCT
GTGGCGAGGGCCATGGGCGAGGCCGAGGGACAGCTTGCGCGCCGCTTGGCCAGGTGTGAGACGCTGGCCCAGTTG
GCCGTTGCACTCGAGACGCTGCTGGTGTCGCCAAGGCGGTCCAGGTGGCGCTTTGTGCTGGTGCTCGATGGCATT
GACCGCCAGCGAGACGGGCCGCCTGTGCTGGTGCCAGCGCTGGCTCGACTATCAGAAACGATTGACCGTCTTGCC
TGCATCTTCATCGTCACGGCGCCGGCCGCCGGCCTGCTGCGCCTGCCTGCCGCACAATACCTCGGCTTTCCTCCC
TACTCCAAGGCGGACTATGTGCGCATCATGGCTCTCACGCCGCCTCGCCAACTGGCCCAGACGACTGTGGCGGAC
ACGAGCCATCTCTGGACACGCTTCTGCGCCACTGTGCACGACGCCCTGATCCGTCCTGCGTCGCGCACACTGCCT
GCTCTGCGCCATGCCTGCCGCGTCTTGTGGCCGCGCTTCACAGCCCCCGTTGCCCGGGGCGAGCTCGGCCCCAAT
GACTTTTCGAGGCTGCTTGTTGCCGCGCGGCCGCTGCTGCAGGACGAGTCGCTGCTGTGTCCCGCCATCATTTCC
TACCGGCCCCTGGCACAAGAGGCTGCATCGACGACGCTTTCCCTTGCAGCAAACACGCCTCCTGCGAGAGATGGA
CCCCTGCGTCTCTTGCCCATGGCTGCGCGCCTGCTTCTCTTGTCTGCATACCTTGCTTCGCACAATGCCGTGCGC
CACGACTTGGTCGTCTTTTCCACGCAGCATCACCGTCGTCGCCGTCGCAGAGCACCCGCTGCCGCCTCGTCGCGC
CCTGGATCCGTCAAGCACCGTCGCATTGCCCGCAAGCTGCTCGGCGCCCATGCCTTTGTCCTCGAGCGCATGCTG
GCCATATTCGAGGCGGTGCGTCTAGAGTGGACTCCCGACGCCTGCTCTCTGGCTGCTGCTGGCCTAGATGCAGAC
GTGGCTGCCGCACTTGCCACCCTGGCCAGCCTGCGCCTCCTTGTCCGAGTCGGTGCTGGAGACGTCATGGACCGT
CGCAGCATCGGCGTAGAGCTTGATGAGTGGCTCATTGAATCATAA
Transcript >OphauB2|2514
ATGAGCGCCAACGACGACGACGGCTTTGCCTTGCCAGACGAGACGGTACTGGCGCCTGTACTGCACAATTTTCCT
GCACGCGAGCGGCAGATTCGCTGGCTGGCTACTCTAGTCTATCCCGAGGCGGCGCCAGTGGCCAATCTTGTGCTG
CATGGCACCGAGGCCACGGGCAAGTCGGCCATGACGGCGCAGCTGCTGCCGTGTCTGGCGGCCAGTTCCCCGACG
GGCTTTGGGCATGCAATAATCAATGTGGCACAGTGCGTATCGGCGCGTCAGCTGTTTGAGCGCATTGTGGATGCT
GTGGCGAGGGCCATGGGCGAGGCCGAGGGACAGCTTGCGCGCCGCTTGGCCAGGTGTGAGACGCTGGCCCAGTTG
GCCGTTGCACTCGAGACGCTGCTGGTGTCGCCAAGGCGGTCCAGGTGGCGCTTTGTGCTGGTGCTCGATGGCATT
GACCGCCAGCGAGACGGGCCGCCTGTGCTGGTGCCAGCGCTGGCTCGACTATCAGAAACGATTGACCGTCTTGCC
TGCATCTTCATCGTCACGGCGCCGGCCGCCGGCCTGCTGCGCCTGCCTGCCGCACAATACCTCGGCTTTCCTCCC
TACTCCAAGGCGGACTATGTGCGCATCATGGCTCTCACGCCGCCTCGCCAACTGGCCCAGACGACTGTGGCGGAC
ACGAGCCATCTCTGGACACGCTTCTGCGCCACTGTGCACGACGCCCTGATCCGTCCTGCGTCGCGCACACTGCCT
GCTCTGCGCCATGCCTGCCGCGTCTTGTGGCCGCGCTTCACAGCCCCCGTTGCCCGGGGCGAGCTCGGCCCCAAT
GACTTTTCGAGGCTGCTTGTTGCCGCGCGGCCGCTGCTGCAGGACGAGTCGCTGCTGTGTCCCGCCATCATTTCC
TACCGGCCCCTGGCACAAGAGGCTGCATCGACGACGCTTTCCCTTGCAGCAAACACGCCTCCTGCGAGAGATGGA
CCCCTGCGTCTCTTGCCCATGGCTGCGCGCCTGCTTCTCTTGTCTGCATACCTTGCTTCGCACAATGCCGTGCGC
CACGACTTGGTCGTCTTTTCCACGCAGCATCACCGTCGTCGCCGTCGCAGAGCACCCGCTGCCGCCTCGTCGCGC
CCTGGATCCGTCAAGCACCGTCGCATTGCCCGCAAGCTGCTCGGCGCCCATGCCTTTGTCCTCGAGCGCATGCTG
GCCATATTCGAGGCGGTGCGTCTAGAGTGGACTCCCGACGCCTGCTCTCTGGCTGCTGCTGGCCTAGATGCAGAC
GTGGCTGCCGCACTTGCCACCCTGGCCAGCCTGCGCCTCCTTGTCCGAGTCGGTGCTGGAGACGTCATGGACCGT
CGCAGCATCGGCGTAGAGCTTGATGAGTGGCTCATTGAATCATAA
Gene >OphauB2|2514
ATGAGCGCCAACGACGACGACGGCTTTGCCTTGCCAGACGAGACGGTACTGGCGCCTGTACTGCACAATTTTCCT
GCACGCGAGCGGCAGATTCGCTGGCTGGCTACTCTAGTCTATGTGAGTGTAGCCAAGAGGCCGGGCTCTGTTGAT
GCACATTGGCTGACGCAAGAGGTGTAGCCCGAGGCGGCGCCAGTGGCCAATCTTGTGCTGCATGGCACCGAGGCC
ACGGGCAAGTCGGCCATGACGGCGCAGCTGCTGCCGTGTCTGGCGGCCAGTTCCCCGACGGGCTTTGGGCATGCA
ATAATCAATGTGGCACAGTGCGTATCGGCGCGTCAGCTGTTTGAGCGCATTGTGGATGCTGTGGCGAGGGCCATG
GGCGAGGCCGAGGGACAGCTTGCGCGCCGCTTGGCCAGGTGTGAGACGCTGGCCCAGTTGGCCGTTGCACTCGAG
ACGCTGCTGGTGTCGCCAAGGCGGTCCAGGTGGCGCTTTGTGCTGGTGCTCGATGGCATTGACCGCCAGCGAGAC
GGGCCGCCTGTGCTGGTGCCAGCGCTGGCTCGACTATCAGAAACGGTGCGAGTGACAGAGAGGCCGACAGAGGCC
GACAGGACGGCAGACAGGGCGGCAAGGGGCTAACGCTGCATCTACTAGATTGACCGTCTTGCCTGCATCTTCATC
GTCACGGCGCCGGCCGCCGGCCTGCTGCGCCTGCCTGCCGCACAATACCTCGGCTTTCCTCCCTACTCCAAGGCG
GACTATGTGCGCATCATGGCTCTCACGCCGCCTCGCCAACTGGCCCAGACGACTGTGGCGGACACGAGCCATCTC
TGGACACGCTTCTGCGCCACTGTGCACGACGCCCTGATCCGTCCTGCGTCGCGCACACTGCCTGCTCTGCGCCAT
GCCTGCCGCGTCTTGTGGCCGCGCTTCACAGCCCCCGTTGCCCGGGGCGAGCTCGGCCCCAATGACTTTTCGAGG
CTGCTTGTTGCCGCGCGGCCGCTGCTGCAGGACGAGTCGCTGCTGTGTCCCGCCATCATTTCCTACCGGCCCCTG
GCACAAGAGGCTGCATCGACGACGCTTTCCCTTGCAGCAAACACGCCTCCTGCGAGAGATGGACCCCTGCGTCTC
TTGCCCATGGCTGCGCGCCTGCTTCTCTTGTCTGCATACCTTGCTTCGCACAATGCCGTGCGCCACGACTTGGTC
GTCTTTTCCACGCAGCATCACCGTCGTCGCCGTCGCAGAGCACCCGCTGCCGCCTCGTCGCGCCCTGGATCCGTC
AAGCACCGTCGCATTGCCCGCAAGCTGCTCGGCGCCCATGCCTTTGTCCTCGAGCGCATGCTGGCCATATTCGAG
GCGGTGCGTCTAGAGTGGACTCCCGACGCCTGCTCTCTGGCTGCTGCTGGCCTAGATGCAGACGTGGCTGCCGCA
CTTGCCACCCTGGCCAGCCTGCGCCTCCTTGTCCGAGTCGGTGCTGGAGACGTCATGGACCGTGCGGGAAAGTGG
AGGATCAATGCTGGCTGGGAAACCGTCAGGGGCATAGGTCGCAGCATCGGCGTAGAGCTTGATGAGTGGCTCATT
GAATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail