Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2513
Gene name
LocationContig_18:135654..142167
Strand+
Gene length (bp)6513
Transcript length (bp)6390
Coding sequence length (bp)6390
Protein length (aa) 2130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09462 Mus7 Mus7/MMS22 family 2.4E-115 1155 1789

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14207|MMS22_SCHPO Protein mms22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mus7 PE=3 SV=1 1072 1419 2.0E-32

GO

GO Term Description Terminal node
GO:0006974 cellular response to DNA damage stimulus Yes
GO:0006281 DNA repair Yes
GO:0005634 nucleus Yes
GO:0031297 replication fork processing Yes
GO:0110165 cellular anatomical entity No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0006950 response to stress No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0045005 DNA-templated DNA replication maintenance of fidelity No
GO:0043226 organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0050896 response to stimulus No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2513
MPNWRERGEVPDSDEDDEDFESQNDEATLLPAADATSEDIWAFPGSQEEKDATEQKFDHPSPLADPPHVDSSPLS
SAPSEDLPRVNDLTIARIDQTFSKKAPENTEQPSEPSAALPDSTSGHGSPPDPIQGRDRGTLSADDPSLLFTSQS
VPQGKRSLRPRKPIQEHPYLLENERYSRILKKHGVKPLRLALQAGQNPEPCKSAPDDVFDQASQESTQDMLAQHS
WPQETRADTQVTGLSDDPFSASSQVTSTPHDTSRPDSPASFQGTTGLYSLDDQDLPELDEILGRPLRATSTKETA
KRQRTPPPSTIRKRRKVVVLDSNPEEALAAPFLKPMANSGSSVILSPHLPPLHPKLSRQDGPPTTLAALSPLLTS
PSGRRNSFSADFSLNKPASDNGVSDLDEANESCESRSDTDEDEDEDAFNSMRRRLRGVLPASWLRLDQNFTRQRA
LEHIKTRRRLKSPEQRYRRGVAQLKKASPSGAAPQIFFDDDSEDEGQEVLNANSPPGNPVSTPPAVLAETNSNFN
KVVQIISDDSDSAFEDNHIDLMMPLRATSRKRQLKITDSINAHRKRHNPGKISENGRQKPSATKRQRVKSRQLPP
PRLGILDVIEADAPSFLKVAARTIKKRQNQGRSSPRRKLIQLATRQDHVDAISVLDDWKAASIPQRDSVTLAARQ
ISKVLGQKVEERRKLVSYERAPIAKPRRLFKRVCAGGSISFGQLGKPEPSAPALQRGTTVGNSTRNRALTMPMHQ
AQLEIEEKELRREILFHKHKRMLDCLYQTSKNLSIPSTLSVAEADDTAAVEAQSTVCTGPNPLQQSRGRGSRFRK
STRPCRINVEAPQYSHANGPLIVENFAPADFGIAETDVDQSKLRGLGPYGTDYSHHFETFPIETRVFFHESTLLG
SGILAFCSNDNFACEMPDSRPRAFMTLDGRILRCGPWDVQVSSEIGILLDMVTEQIENELVDDLSRVDKSVPVSA
ASFILTYVKDSVTFTDESDVRSFAARLYECLLTLNQRVGPTLDKVDDESKSKLGLILMVYDRLLLTVLIVLKIVA
SHSTAASLTAERVQMEDLLTEMAKTVMSILCKLGSSPMTQMYEDLKLIRPRERGIRGDRPSIHSWVLVMRVLDIA
HMPRASFWDVLHAVMVSPAVVASGDAAQYERCWELVFSLLPLTQFNKWGIVDVGDGRPSAGPEGWTIAQSLLKTV
LCAYQRNNHQPPSFNNYCRALVARCYYLVQHWGWRKSGGVVGTIFDFFGSQNLAHLRNEEADQSPRFIEELARRP
KLDIEPSDRCFHIFLKLVALSIGKMDEAGAAKDIRNLVARMIPNHNRQYLRDQAVHARELAALRNHHDLLGTLFW
AAPVEMRPAVSLMERLVVPGNSHKAACLINLRCWRQLSRFIVASGEASRTLRPLTRWRDTFFQQVLDQFHSVAPD
VQQQVLAYSRQLGERIGDQVVNETISLNKRSVMDILYASVESSLDVMQHAPNLESATFCFNPLQLRTVFEQSLDG
TLGPDWAMLRACLATLGSFLTHIETSKDKEESQPGESQAGTSDDKEESQQSDYQISNSVLADDALMQLDQNLANV
FFSLARRVLLMPGEHVETAQVECLDQMVVLAARMTLLLVDAGVLRLCDMFGQGRFGLFDGTPHKLDLHQRRYLHL
FVLTMLQRGFNDWTGIDFDLLELWVSILVQPRDCLAYETSLGSELWRRRATFVPESVMSLVTRPDYPSNVALFEF
AVSDMRQRTRLASKSTQGTQATNGSRNTLKLMMEQIKSDLKTLSANDPPEHGSYVKFVQDIISLVKSHGSDMCAI
DDYFYQISKEYAPSAQDPQLQVAKLVSYGLRLEEGDGKAARPLFFLLLNNVKSAMMKDELRREVVMLYKGMQNWG
VAQFVLSKMLPAIILSCLRNSSAFPLMDIYAKALQLLLDRHVFSHELTERDMDWVCILVRATVRGIHDMFGSRRV
LLCASQVHVFEQVLGVLNLIWPSLVALSMTGASFDSLTEVLRSLEHMSTFVRAAKSDLEQVMQAGSETVHLEWPQ
PLAMQEEVQLDHEVQVLADDLAQDVERNWNMTSEAISIQTPGRRHGQDVVLGALMPVWDMGKMVHELHERAEEWC
WRWLQLTEHHVDEVDEVDDGPNVLEAFVF*
Coding >OphauB2|2513
ATGCCCAACTGGAGAGAACGGGGAGAGGTGCCGGATTCTGACGAGGACGATGAAGATTTTGAGAGCCAAAACGAT
GAAGCGACATTGCTCCCCGCTGCAGATGCGACATCAGAAGACATTTGGGCCTTTCCAGGCTCTCAAGAAGAAAAA
GATGCCACAGAGCAAAAGTTTGACCATCCATCACCACTGGCGGACCCTCCTCATGTGGACTCATCGCCATTATCA
TCGGCGCCCAGCGAAGACTTGCCCCGTGTCAATGATTTGACTATAGCTCGGATAGATCAGACTTTTTCTAAAAAA
GCACCCGAAAACACCGAGCAGCCTTCTGAGCCCTCGGCCGCATTACCGGACTCTACAAGTGGACATGGATCTCCT
CCAGATCCAATCCAGGGCAGGGACAGAGGAACATTATCAGCGGACGATCCGAGTCTACTATTTACTTCACAGTCC
GTTCCGCAGGGCAAAAGGTCTCTCCGACCCCGAAAACCGATCCAAGAGCATCCCTATCTACTTGAAAATGAGCGA
TACAGCAGAATTCTCAAGAAACATGGCGTCAAACCCTTGAGGCTAGCTTTACAGGCAGGCCAGAACCCAGAGCCG
TGCAAATCAGCTCCCGACGATGTTTTCGACCAAGCCAGCCAGGAGTCTACGCAAGACATGCTTGCGCAGCATAGC
TGGCCTCAGGAGACTCGAGCAGACACGCAAGTCACGGGGTTATCAGACGACCCCTTCTCAGCCTCGTCGCAAGTT
ACCAGTACTCCCCATGACACGAGTCGCCCCGACAGCCCAGCTAGCTTCCAAGGTACCACAGGCCTTTACAGCCTC
GACGACCAGGATCTCCCTGAGCTAGATGAGATTCTCGGTAGGCCACTCCGTGCAACTTCAACAAAGGAAACAGCC
AAGCGTCAAAGAACGCCGCCGCCTTCAACGATACGAAAACGTCGCAAAGTCGTGGTTCTTGACAGCAATCCAGAA
GAGGCTTTGGCCGCGCCTTTTTTGAAACCGATGGCCAACTCTGGAAGTTCAGTCATTCTGTCCCCGCATCTTCCT
CCTCTTCATCCAAAGCTGAGCCGCCAAGATGGTCCTCCAACCACATTGGCGGCTCTATCTCCTCTGCTGACATCC
CCGTCGGGACGGCGCAATTCCTTCTCGGCCGACTTTTCGCTCAACAAGCCAGCATCAGATAACGGCGTCTCTGAT
CTTGACGAAGCAAACGAGTCCTGCGAATCCCGTAGCGATACCGATGAGGATGAGGATGAGGATGCCTTTAATTCC
ATGAGACGACGACTTAGAGGCGTTCTTCCTGCATCATGGCTGCGACTTGACCAAAACTTTACTCGCCAACGTGCC
CTGGAACATATAAAAACTCGCCGACGTCTAAAGTCACCAGAGCAAAGGTACCGACGAGGGGTTGCGCAGTTGAAG
AAGGCTTCTCCGAGTGGCGCTGCACCACAAATTTTCTTTGATGATGATTCTGAAGATGAAGGCCAAGAGGTGCTC
AACGCCAACTCTCCACCAGGCAATCCAGTTTCTACTCCACCAGCAGTTCTTGCTGAAACCAATTCGAATTTCAAC
AAGGTGGTCCAAATCATATCCGATGATTCAGACTCGGCATTTGAAGATAACCATATCGACTTGATGATGCCCCTG
CGAGCTACAAGCAGGAAACGCCAACTCAAAATTACTGATTCGATAAATGCACATCGAAAGCGGCACAATCCTGGC
AAGATTTCTGAAAACGGGAGACAGAAACCAAGCGCCACGAAACGGCAGCGTGTAAAATCACGCCAGCTGCCACCA
CCTCGCCTTGGAATTCTCGACGTCATTGAAGCAGATGCTCCATCTTTCCTCAAGGTAGCAGCTCGCACAATCAAG
AAACGACAGAATCAAGGCCGTTCCAGTCCTCGACGCAAGTTGATACAACTTGCTACGAGACAAGATCATGTAGAC
GCTATTTCTGTTTTGGATGATTGGAAAGCTGCATCAATACCTCAACGCGATTCTGTCACTCTTGCGGCTCGCCAA
ATTTCCAAGGTGCTCGGCCAAAAGGTGGAAGAGAGAAGGAAGCTTGTTTCGTATGAGCGAGCACCTATAGCAAAG
CCACGCAGGCTATTTAAACGTGTTTGTGCCGGAGGGTCAATATCTTTTGGACAGCTGGGGAAGCCCGAGCCCTCA
GCTCCGGCGTTGCAGCGTGGCACCACGGTTGGCAACTCGACACGGAATCGGGCACTGACGATGCCGATGCATCAA
GCGCAGCTAGAAATCGAAGAGAAAGAGCTGAGAAGGGAGATTTTGTTCCACAAGCACAAGAGAATGCTCGATTGT
CTCTATCAAACCAGTAAAAACTTGTCAATACCTTCAACTCTCTCTGTCGCAGAGGCAGACGATACTGCAGCTGTT
GAAGCTCAGTCGACCGTTTGCACCGGACCAAACCCTTTACAGCAATCTCGAGGACGCGGGTCTCGTTTCCGAAAG
AGCACAAGGCCCTGCCGTATCAATGTCGAGGCACCGCAGTATAGCCACGCAAATGGGCCCCTCATTGTTGAGAAT
TTTGCGCCTGCCGATTTTGGAATAGCCGAGACTGATGTTGATCAGAGCAAGTTGCGCGGGCTAGGTCCCTATGGG
ACTGATTACAGCCACCATTTTGAGACTTTTCCTATTGAGACTCGCGTCTTTTTCCACGAATCAACGCTTCTGGGT
AGTGGTATTTTGGCATTTTGCTCCAATGACAATTTCGCGTGCGAGATGCCCGATTCTCGGCCGCGAGCCTTTATG
ACTCTGGACGGACGAATTCTCCGATGTGGTCCTTGGGATGTTCAAGTGTCGTCAGAAATCGGCATTCTGCTAGAC
ATGGTGACGGAACAAATTGAAAATGAGTTGGTGGACGACTTGAGTCGAGTGGACAAGTCGGTACCTGTGTCTGCG
GCCTCGTTCATTTTGACCTATGTCAAAGACTCGGTGACCTTTACCGACGAGAGCGATGTCAGATCATTTGCGGCA
CGACTATACGAATGTCTTTTGACCTTGAACCAACGGGTGGGCCCCACACTTGACAAAGTCGATGATGAATCGAAA
TCAAAACTCGGCCTCATACTCATGGTTTATGATCGACTGCTATTGACTGTTTTGATCGTGCTGAAGATTGTAGCT
AGTCATTCAACGGCAGCGTCATTGACGGCAGAGCGAGTCCAGATGGAGGATTTATTGACAGAAATGGCAAAGACA
GTCATGTCCATCTTGTGCAAGCTGGGATCAAGCCCCATGACTCAGATGTACGAAGACCTCAAGCTAATACGACCT
AGAGAGCGTGGAATTCGAGGCGATAGACCCTCTATTCATTCCTGGGTGTTGGTTATGAGGGTTTTAGACATTGCA
CACATGCCTCGGGCATCGTTTTGGGACGTGCTTCATGCAGTGATGGTGTCACCAGCTGTTGTTGCAAGTGGAGAT
GCAGCCCAGTATGAACGCTGCTGGGAACTCGTTTTTTCGCTTCTGCCTCTGACTCAGTTCAACAAGTGGGGAATT
GTTGACGTTGGTGATGGCCGGCCGAGTGCAGGACCGGAGGGCTGGACCATAGCTCAGAGCCTCCTCAAGACTGTC
TTGTGCGCTTATCAAAGGAACAACCACCAGCCACCAAGCTTCAACAACTACTGTCGGGCTCTTGTTGCACGATGT
TACTACCTAGTGCAGCATTGGGGCTGGCGCAAGTCTGGCGGCGTGGTGGGAACAATATTTGATTTCTTTGGCTCA
CAAAACCTGGCGCATCTTCGCAATGAAGAGGCAGACCAGTCGCCGAGGTTTATCGAGGAGCTTGCACGGCGACCA
AAGCTGGACATTGAGCCGAGTGACCGATGCTTCCACATTTTCCTCAAGCTTGTTGCCCTCAGCATTGGCAAGATG
GACGAAGCGGGAGCGGCCAAGGATATCCGCAACTTGGTTGCTAGAATGATTCCAAATCACAACCGCCAGTACCTC
AGAGACCAAGCTGTGCATGCCCGGGAGTTGGCAGCCCTGAGGAACCACCACGATCTTCTTGGGACTCTGTTTTGG
GCAGCTCCAGTGGAGATGCGGCCGGCGGTAAGCCTCATGGAACGCCTTGTGGTGCCTGGAAACTCGCACAAAGCT
GCGTGCCTTATTAATCTCCGGTGCTGGCGGCAGCTCTCGCGCTTCATTGTGGCATCAGGAGAGGCATCGCGGACC
CTGAGACCGTTGACGCGGTGGCGCGACACCTTTTTCCAACAAGTCCTGGACCAGTTTCACTCGGTGGCTCCAGAC
GTTCAGCAGCAAGTGCTGGCGTATTCCAGACAACTGGGAGAGCGCATTGGCGACCAAGTAGTCAATGAAACCATT
TCACTCAACAAACGAAGCGTCATGGACATATTGTACGCATCAGTCGAGTCGTCTTTGGATGTGATGCAGCATGCC
CCCAATCTGGAGTCGGCTACCTTTTGTTTCAACCCACTGCAGCTTCGGACAGTCTTTGAGCAAAGCCTTGACGGC
ACCTTGGGGCCAGATTGGGCCATGCTGCGAGCATGCCTCGCCACGTTGGGCTCATTTCTCACCCATATTGAAACG
TCCAAGGATAAGGAGGAAAGTCAACCGGGCGAGTCTCAGGCTGGCACAAGCGACGACAAGGAGGAAAGCCAGCAG
AGCGACTATCAAATCTCAAATTCTGTCTTGGCCGACGATGCTTTGATGCAACTTGATCAAAACCTGGCCAATGTC
TTTTTCTCGCTAGCCAGACGTGTTTTACTCATGCCAGGCGAACATGTGGAGACGGCCCAAGTGGAATGTTTGGAC
CAAATGGTGGTGCTGGCAGCAAGGATGACTTTACTCTTGGTCGATGCAGGCGTCTTGCGCCTCTGCGACATGTTT
GGCCAGGGACGCTTTGGCTTGTTTGACGGGACACCTCACAAGCTTGATTTGCATCAACGCCGCTACCTGCATCTC
TTTGTCTTGACAATGCTGCAGCGCGGGTTCAACGACTGGACGGGCATAGACTTTGACCTGCTGGAACTATGGGTT
TCTATCTTGGTACAGCCGCGAGACTGTCTTGCCTACGAGACGAGTCTTGGCTCGGAATTATGGCGCAGAAGAGCC
ACCTTTGTTCCCGAGAGTGTCATGAGCCTCGTAACCCGACCCGATTATCCCTCCAACGTGGCCTTGTTTGAATTC
GCCGTGTCGGACATGCGGCAGCGGACCCGCCTCGCGAGCAAATCGACACAGGGGACGCAAGCCACCAATGGCTCC
AGGAACACACTAAAGCTCATGATGGAGCAAATCAAGAGCGACTTGAAGACTCTGTCGGCAAACGATCCTCCGGAA
CATGGCAGCTATGTCAAATTTGTCCAGGACATTATTTCTCTTGTAAAGTCGCATGGATCTGACATGTGTGCGATT
GACGACTATTTTTACCAAATCAGCAAGGAGTATGCACCAAGTGCCCAGGACCCTCAGCTTCAAGTGGCTAAGCTG
GTCTCTTATGGACTGCGACTTGAAGAGGGTGATGGCAAAGCCGCCCGGCCCTTGTTTTTCCTGCTCCTCAACAAT
GTCAAATCGGCCATGATGAAGGATGAGCTGAGACGCGAAGTGGTTATGCTGTACAAGGGAATGCAAAATTGGGGT
GTTGCGCAATTTGTGCTGAGCAAGATGCTTCCAGCCATTATCTTGTCATGCCTCCGCAACAGCTCGGCCTTTCCA
TTGATGGACATTTATGCCAAGGCGCTACAGCTACTACTTGACCGACATGTCTTTTCTCATGAGCTCACCGAGCGA
GACATGGACTGGGTGTGCATCTTGGTGCGCGCTACCGTGCGAGGAATACACGACATGTTTGGGAGCAGACGTGTG
CTGCTGTGTGCGTCGCAGGTGCACGTTTTTGAGCAAGTTTTGGGTGTGCTAAATCTAATTTGGCCGTCTCTTGTT
GCCTTGTCAATGACGGGGGCTTCATTTGACAGCTTGACAGAGGTCTTGAGGAGTCTTGAGCACATGAGCACATTT
GTCAGGGCAGCCAAGTCGGACTTGGAGCAGGTGATGCAGGCAGGATCGGAAACAGTACATCTCGAGTGGCCACAG
CCCTTGGCGATGCAAGAAGAGGTGCAGCTGGACCACGAGGTGCAAGTGTTGGCGGATGATTTGGCTCAAGACGTG
GAGAGGAATTGGAATATGACAAGTGAGGCTATTTCGATACAGACACCGGGGAGAAGACATGGGCAGGATGTAGTG
CTAGGGGCGCTGATGCCAGTGTGGGACATGGGGAAAATGGTGCACGAGTTGCATGAGCGGGCCGAGGAGTGGTGT
TGGCGTTGGTTGCAATTGACTGAGCATCATGTGGATGAGGTGGATGAGGTGGATGATGGGCCCAATGTGCTCGAG
GCGTTTGTGTTTTGA
Transcript >OphauB2|2513
ATGCCCAACTGGAGAGAACGGGGAGAGGTGCCGGATTCTGACGAGGACGATGAAGATTTTGAGAGCCAAAACGAT
GAAGCGACATTGCTCCCCGCTGCAGATGCGACATCAGAAGACATTTGGGCCTTTCCAGGCTCTCAAGAAGAAAAA
GATGCCACAGAGCAAAAGTTTGACCATCCATCACCACTGGCGGACCCTCCTCATGTGGACTCATCGCCATTATCA
TCGGCGCCCAGCGAAGACTTGCCCCGTGTCAATGATTTGACTATAGCTCGGATAGATCAGACTTTTTCTAAAAAA
GCACCCGAAAACACCGAGCAGCCTTCTGAGCCCTCGGCCGCATTACCGGACTCTACAAGTGGACATGGATCTCCT
CCAGATCCAATCCAGGGCAGGGACAGAGGAACATTATCAGCGGACGATCCGAGTCTACTATTTACTTCACAGTCC
GTTCCGCAGGGCAAAAGGTCTCTCCGACCCCGAAAACCGATCCAAGAGCATCCCTATCTACTTGAAAATGAGCGA
TACAGCAGAATTCTCAAGAAACATGGCGTCAAACCCTTGAGGCTAGCTTTACAGGCAGGCCAGAACCCAGAGCCG
TGCAAATCAGCTCCCGACGATGTTTTCGACCAAGCCAGCCAGGAGTCTACGCAAGACATGCTTGCGCAGCATAGC
TGGCCTCAGGAGACTCGAGCAGACACGCAAGTCACGGGGTTATCAGACGACCCCTTCTCAGCCTCGTCGCAAGTT
ACCAGTACTCCCCATGACACGAGTCGCCCCGACAGCCCAGCTAGCTTCCAAGGTACCACAGGCCTTTACAGCCTC
GACGACCAGGATCTCCCTGAGCTAGATGAGATTCTCGGTAGGCCACTCCGTGCAACTTCAACAAAGGAAACAGCC
AAGCGTCAAAGAACGCCGCCGCCTTCAACGATACGAAAACGTCGCAAAGTCGTGGTTCTTGACAGCAATCCAGAA
GAGGCTTTGGCCGCGCCTTTTTTGAAACCGATGGCCAACTCTGGAAGTTCAGTCATTCTGTCCCCGCATCTTCCT
CCTCTTCATCCAAAGCTGAGCCGCCAAGATGGTCCTCCAACCACATTGGCGGCTCTATCTCCTCTGCTGACATCC
CCGTCGGGACGGCGCAATTCCTTCTCGGCCGACTTTTCGCTCAACAAGCCAGCATCAGATAACGGCGTCTCTGAT
CTTGACGAAGCAAACGAGTCCTGCGAATCCCGTAGCGATACCGATGAGGATGAGGATGAGGATGCCTTTAATTCC
ATGAGACGACGACTTAGAGGCGTTCTTCCTGCATCATGGCTGCGACTTGACCAAAACTTTACTCGCCAACGTGCC
CTGGAACATATAAAAACTCGCCGACGTCTAAAGTCACCAGAGCAAAGGTACCGACGAGGGGTTGCGCAGTTGAAG
AAGGCTTCTCCGAGTGGCGCTGCACCACAAATTTTCTTTGATGATGATTCTGAAGATGAAGGCCAAGAGGTGCTC
AACGCCAACTCTCCACCAGGCAATCCAGTTTCTACTCCACCAGCAGTTCTTGCTGAAACCAATTCGAATTTCAAC
AAGGTGGTCCAAATCATATCCGATGATTCAGACTCGGCATTTGAAGATAACCATATCGACTTGATGATGCCCCTG
CGAGCTACAAGCAGGAAACGCCAACTCAAAATTACTGATTCGATAAATGCACATCGAAAGCGGCACAATCCTGGC
AAGATTTCTGAAAACGGGAGACAGAAACCAAGCGCCACGAAACGGCAGCGTGTAAAATCACGCCAGCTGCCACCA
CCTCGCCTTGGAATTCTCGACGTCATTGAAGCAGATGCTCCATCTTTCCTCAAGGTAGCAGCTCGCACAATCAAG
AAACGACAGAATCAAGGCCGTTCCAGTCCTCGACGCAAGTTGATACAACTTGCTACGAGACAAGATCATGTAGAC
GCTATTTCTGTTTTGGATGATTGGAAAGCTGCATCAATACCTCAACGCGATTCTGTCACTCTTGCGGCTCGCCAA
ATTTCCAAGGTGCTCGGCCAAAAGGTGGAAGAGAGAAGGAAGCTTGTTTCGTATGAGCGAGCACCTATAGCAAAG
CCACGCAGGCTATTTAAACGTGTTTGTGCCGGAGGGTCAATATCTTTTGGACAGCTGGGGAAGCCCGAGCCCTCA
GCTCCGGCGTTGCAGCGTGGCACCACGGTTGGCAACTCGACACGGAATCGGGCACTGACGATGCCGATGCATCAA
GCGCAGCTAGAAATCGAAGAGAAAGAGCTGAGAAGGGAGATTTTGTTCCACAAGCACAAGAGAATGCTCGATTGT
CTCTATCAAACCAGTAAAAACTTGTCAATACCTTCAACTCTCTCTGTCGCAGAGGCAGACGATACTGCAGCTGTT
GAAGCTCAGTCGACCGTTTGCACCGGACCAAACCCTTTACAGCAATCTCGAGGACGCGGGTCTCGTTTCCGAAAG
AGCACAAGGCCCTGCCGTATCAATGTCGAGGCACCGCAGTATAGCCACGCAAATGGGCCCCTCATTGTTGAGAAT
TTTGCGCCTGCCGATTTTGGAATAGCCGAGACTGATGTTGATCAGAGCAAGTTGCGCGGGCTAGGTCCCTATGGG
ACTGATTACAGCCACCATTTTGAGACTTTTCCTATTGAGACTCGCGTCTTTTTCCACGAATCAACGCTTCTGGGT
AGTGGTATTTTGGCATTTTGCTCCAATGACAATTTCGCGTGCGAGATGCCCGATTCTCGGCCGCGAGCCTTTATG
ACTCTGGACGGACGAATTCTCCGATGTGGTCCTTGGGATGTTCAAGTGTCGTCAGAAATCGGCATTCTGCTAGAC
ATGGTGACGGAACAAATTGAAAATGAGTTGGTGGACGACTTGAGTCGAGTGGACAAGTCGGTACCTGTGTCTGCG
GCCTCGTTCATTTTGACCTATGTCAAAGACTCGGTGACCTTTACCGACGAGAGCGATGTCAGATCATTTGCGGCA
CGACTATACGAATGTCTTTTGACCTTGAACCAACGGGTGGGCCCCACACTTGACAAAGTCGATGATGAATCGAAA
TCAAAACTCGGCCTCATACTCATGGTTTATGATCGACTGCTATTGACTGTTTTGATCGTGCTGAAGATTGTAGCT
AGTCATTCAACGGCAGCGTCATTGACGGCAGAGCGAGTCCAGATGGAGGATTTATTGACAGAAATGGCAAAGACA
GTCATGTCCATCTTGTGCAAGCTGGGATCAAGCCCCATGACTCAGATGTACGAAGACCTCAAGCTAATACGACCT
AGAGAGCGTGGAATTCGAGGCGATAGACCCTCTATTCATTCCTGGGTGTTGGTTATGAGGGTTTTAGACATTGCA
CACATGCCTCGGGCATCGTTTTGGGACGTGCTTCATGCAGTGATGGTGTCACCAGCTGTTGTTGCAAGTGGAGAT
GCAGCCCAGTATGAACGCTGCTGGGAACTCGTTTTTTCGCTTCTGCCTCTGACTCAGTTCAACAAGTGGGGAATT
GTTGACGTTGGTGATGGCCGGCCGAGTGCAGGACCGGAGGGCTGGACCATAGCTCAGAGCCTCCTCAAGACTGTC
TTGTGCGCTTATCAAAGGAACAACCACCAGCCACCAAGCTTCAACAACTACTGTCGGGCTCTTGTTGCACGATGT
TACTACCTAGTGCAGCATTGGGGCTGGCGCAAGTCTGGCGGCGTGGTGGGAACAATATTTGATTTCTTTGGCTCA
CAAAACCTGGCGCATCTTCGCAATGAAGAGGCAGACCAGTCGCCGAGGTTTATCGAGGAGCTTGCACGGCGACCA
AAGCTGGACATTGAGCCGAGTGACCGATGCTTCCACATTTTCCTCAAGCTTGTTGCCCTCAGCATTGGCAAGATG
GACGAAGCGGGAGCGGCCAAGGATATCCGCAACTTGGTTGCTAGAATGATTCCAAATCACAACCGCCAGTACCTC
AGAGACCAAGCTGTGCATGCCCGGGAGTTGGCAGCCCTGAGGAACCACCACGATCTTCTTGGGACTCTGTTTTGG
GCAGCTCCAGTGGAGATGCGGCCGGCGGTAAGCCTCATGGAACGCCTTGTGGTGCCTGGAAACTCGCACAAAGCT
GCGTGCCTTATTAATCTCCGGTGCTGGCGGCAGCTCTCGCGCTTCATTGTGGCATCAGGAGAGGCATCGCGGACC
CTGAGACCGTTGACGCGGTGGCGCGACACCTTTTTCCAACAAGTCCTGGACCAGTTTCACTCGGTGGCTCCAGAC
GTTCAGCAGCAAGTGCTGGCGTATTCCAGACAACTGGGAGAGCGCATTGGCGACCAAGTAGTCAATGAAACCATT
TCACTCAACAAACGAAGCGTCATGGACATATTGTACGCATCAGTCGAGTCGTCTTTGGATGTGATGCAGCATGCC
CCCAATCTGGAGTCGGCTACCTTTTGTTTCAACCCACTGCAGCTTCGGACAGTCTTTGAGCAAAGCCTTGACGGC
ACCTTGGGGCCAGATTGGGCCATGCTGCGAGCATGCCTCGCCACGTTGGGCTCATTTCTCACCCATATTGAAACG
TCCAAGGATAAGGAGGAAAGTCAACCGGGCGAGTCTCAGGCTGGCACAAGCGACGACAAGGAGGAAAGCCAGCAG
AGCGACTATCAAATCTCAAATTCTGTCTTGGCCGACGATGCTTTGATGCAACTTGATCAAAACCTGGCCAATGTC
TTTTTCTCGCTAGCCAGACGTGTTTTACTCATGCCAGGCGAACATGTGGAGACGGCCCAAGTGGAATGTTTGGAC
CAAATGGTGGTGCTGGCAGCAAGGATGACTTTACTCTTGGTCGATGCAGGCGTCTTGCGCCTCTGCGACATGTTT
GGCCAGGGACGCTTTGGCTTGTTTGACGGGACACCTCACAAGCTTGATTTGCATCAACGCCGCTACCTGCATCTC
TTTGTCTTGACAATGCTGCAGCGCGGGTTCAACGACTGGACGGGCATAGACTTTGACCTGCTGGAACTATGGGTT
TCTATCTTGGTACAGCCGCGAGACTGTCTTGCCTACGAGACGAGTCTTGGCTCGGAATTATGGCGCAGAAGAGCC
ACCTTTGTTCCCGAGAGTGTCATGAGCCTCGTAACCCGACCCGATTATCCCTCCAACGTGGCCTTGTTTGAATTC
GCCGTGTCGGACATGCGGCAGCGGACCCGCCTCGCGAGCAAATCGACACAGGGGACGCAAGCCACCAATGGCTCC
AGGAACACACTAAAGCTCATGATGGAGCAAATCAAGAGCGACTTGAAGACTCTGTCGGCAAACGATCCTCCGGAA
CATGGCAGCTATGTCAAATTTGTCCAGGACATTATTTCTCTTGTAAAGTCGCATGGATCTGACATGTGTGCGATT
GACGACTATTTTTACCAAATCAGCAAGGAGTATGCACCAAGTGCCCAGGACCCTCAGCTTCAAGTGGCTAAGCTG
GTCTCTTATGGACTGCGACTTGAAGAGGGTGATGGCAAAGCCGCCCGGCCCTTGTTTTTCCTGCTCCTCAACAAT
GTCAAATCGGCCATGATGAAGGATGAGCTGAGACGCGAAGTGGTTATGCTGTACAAGGGAATGCAAAATTGGGGT
GTTGCGCAATTTGTGCTGAGCAAGATGCTTCCAGCCATTATCTTGTCATGCCTCCGCAACAGCTCGGCCTTTCCA
TTGATGGACATTTATGCCAAGGCGCTACAGCTACTACTTGACCGACATGTCTTTTCTCATGAGCTCACCGAGCGA
GACATGGACTGGGTGTGCATCTTGGTGCGCGCTACCGTGCGAGGAATACACGACATGTTTGGGAGCAGACGTGTG
CTGCTGTGTGCGTCGCAGGTGCACGTTTTTGAGCAAGTTTTGGGTGTGCTAAATCTAATTTGGCCGTCTCTTGTT
GCCTTGTCAATGACGGGGGCTTCATTTGACAGCTTGACAGAGGTCTTGAGGAGTCTTGAGCACATGAGCACATTT
GTCAGGGCAGCCAAGTCGGACTTGGAGCAGGTGATGCAGGCAGGATCGGAAACAGTACATCTCGAGTGGCCACAG
CCCTTGGCGATGCAAGAAGAGGTGCAGCTGGACCACGAGGTGCAAGTGTTGGCGGATGATTTGGCTCAAGACGTG
GAGAGGAATTGGAATATGACAAGTGAGGCTATTTCGATACAGACACCGGGGAGAAGACATGGGCAGGATGTAGTG
CTAGGGGCGCTGATGCCAGTGTGGGACATGGGGAAAATGGTGCACGAGTTGCATGAGCGGGCCGAGGAGTGGTGT
TGGCGTTGGTTGCAATTGACTGAGCATCATGTGGATGAGGTGGATGAGGTGGATGATGGGCCCAATGTGCTCGAG
GCGTTTGTGTTTTGA
Gene >OphauB2|2513
ATGCCCAACTGGAGAGAACGGGGAGAGGTGCCGGATTCTGACGAGGACGATGAAGATTTTGAGAGCCAAAACGAT
GAAGCGACATTGCTCCCCGCTGCAGATGCGACATCAGAAGACATTTGGGCCTTTCCAGGCTCTCAAGAAGAAAAA
GATGCCACAGAGCAAAAGTTTGACCATCCATCACCACTGGCGGACCCTCCTCATGTGGACTCATCGCCATTATCA
TCGGCGCCCAGCGAAGACTTGCCCCGTGTCAATGATTTGACTATAGCTCGGATAGATCAGACTTTTTCTAAAAAA
GCACCCGAAAACACCGAGCAGCCTTCTGAGCCCTCGGCCGCATTACCGGACTCTACAAGTGGACATGGATCTCCT
CCAGATCCAATCCAGGGCAGGGACAGAGGAACATTATCAGCGGACGATCCGAGTCTACTATTTACTTCACAGTCC
GTTCCGCAGGGCAAAAGGTCTCTCCGACCCCGAAAACCGATCCAAGAGCATCCCTATCTACTTGAAAATGAGCGA
TACAGCAGAATTCTCAAGAAACATGGCGTCAAACCCTTGAGGCTAGCTTTACAGGCAGGCCAGAACCCAGAGCCG
TGCAAATCAGCTCCCGACGATGTTTTCGACCAAGCCAGCCAGGAGTCTACGCAAGACATGCTTGCGCAGCATAGC
TGGCCTCAGGAGACTCGAGCAGACACGCAAGTCACGGGGTTATCAGACGACCCCTTCTCAGCCTCGTCGCAAGTT
ACCAGTACTCCCCATGACACGAGTCGCCCCGACAGCCCAGCTAGCTTCCAAGGTACCACAGGCCTTTACAGCCTC
GACGACCAGGATCTCCCTGAGCTAGATGAGATTCTCGGTAGGCCACTCCGTGCAACTTCAACAAAGGAAACAGCC
AAGCGTCAAAGAACGCCGCCGCCTTCAACGATACGAAAACGTCGCAAAGTCGTGGTTCTTGACAGCAATCCAGAA
GAGGCTTTGGCCGCGCCTTTTTTGAAACCGATGGCCAACTCTGGAAGTTCAGTCATTCTGTCCCCGCATCTTCCT
CCTCTTCATCCAAAGCTGAGCCGCCAAGATGGTCCTCCAACCACATTGGCGGCTCTATCTCCTCTGCTGACATCC
CCGTCGGGACGGCGCAATTCCTTCTCGGCCGACTTTTCGCTCAACAAGCCAGCATCAGATAACGGCGTCTCTGAT
CTTGACGAAGCAAACGAGTCCTGCGAATCCCGTAGCGATACCGATGAGGATGAGGATGAGGATGCCTTTAATTCC
ATGAGACGACGACTTAGAGGCGTTCTTCCTGCATCATGGCTGCGACTTGACCAAAACTTTACTCGCCAACGTGCC
CTGGAACATATAAAAACTCGCCGACGTCTAAAGTCACCAGAGCAAAGGTACCGACGAGGGGTTGCGCAGTTGAAG
AAGGCTTCTCCGAGTGGCGCTGCACCACAAATTTTCTTTGATGATGATTCTGAAGATGAAGGCCAAGAGGTGCTC
AACGCCAACTCTCCACCAGGCAATCCAGTTTCTACTCCACCAGCAGTTCTTGCTGAAACCAATTCGAATTTCAAC
AAGGTGGTCCAAATCATATCCGATGATTCAGACTCGGCATTTGAAGATAACCATATCGACTTGATGATGCCCCTG
CGAGCTACAAGCAGGAAACGCCAACTCAAAATTACTGATTCGATAAATGCACATCGAAAGCGGCACAATCCTGGC
AAGATTTCTGAAAACGGGTCAAGGCAAGGGCAACAAAGGATATTCAGGCAATCAAAGATTAGCACTTACGCGAAT
AAGTCTCGGAGAGATGCTCCATCTGCAGCAATTTCAACGTCAATGAAAAGAAAAAGCGCCTCCAGGAGACAGAAA
CCAAGCGCCACGAAACGGCAGCGTGTAAAATCACGCCAGCTGCCACCACCTCGCCTTGGAATTCTCGACGTCATT
GAAGCAGATGCTCCATCTTTCCTCAAGGTAGCAGCTCGCACAATCAAGAAACGACAGAATCAAGGCCGTTCCAGT
CCTCGACGCAAGTTGATACAACTTGCTACGAGACAAGATCATGTAGACGCTATTTCTGTTTTGGATGATTGGAAA
GCTGCATCAATACCTCAACGCGATTCTGTCACTCTTGCGGCTCGCCAAATTTCCAAGGTGCTCGGCCAAAAGGTG
GAAGAGAGAAGGAAGCTTGTTTCGTATGAGCGAGCACCTATAGCAAAGCCACGCAGGCTATTTAAACGTGTTTGT
GCCGGAGGGTCAATATCTTTTGGACAGCTGGGGAAGCCCGAGCCCTCAGCTCCGGCGTTGCAGCGTGGCACCACG
GTTGGCAACTCGACACGGAATCGGGCACTGACGATGCCGATGCATCAAGCGCAGCTAGAAATCGAAGAGAAAGAG
CTGAGAAGGGAGATTTTGTTCCACAAGCACAAGAGAATGCTCGATTGTCTCTATCAAACCAGTAAAAACTTGTCA
ATACCTTCAACTCTCTCTGTCGCAGAGGCAGACGATACTGCAGCTGTTGAAGCTCAGTCGACCGTTTGCACCGGA
CCAAACCCTTTACAGCAATCTCGAGGACGCGGGTCTCGTTTCCGAAAGAGCACAAGGCCCTGCCGTATCAATGTC
GAGGCACCGCAGTATAGCCACGCAAATGGGCCCCTCATTGTTGAGAATTTTGCGCCTGCCGATTTTGGAATAGCC
GAGACTGATGTTGATCAGAGCAAGTTGCGCGGGCTAGGTCCCTATGGGACTGATTACAGCCACCATTTTGAGACT
TTTCCTATTGAGACTCGCGTCTTTTTCCACGAATCAACGCTTCTGGGTAGTGGTATTTTGGCATTTTGCTCCAAT
GACAATTTCGCGTGCGAGATGCCCGATTCTCGGCCGCGAGCCTTTATGACTCTGGACGGACGAATTCTCCGATGT
GGTCCTTGGGATGTTCAAGTGTCGTCAGAAATCGGCATTCTGCTAGACATGGTGACGGAACAAATTGAAAATGAG
TTGGTGGACGACTTGAGTCGAGTGGACAAGTCGGTACCTGTGTCTGCGGCCTCGTTCATTTTGACCTATGTCAAA
GACTCGGTGACCTTTACCGACGAGAGCGATGTCAGATCATTTGCGGCACGACTATACGAATGTCTTTTGACCTTG
AACCAACGGGTGGGCCCCACACTTGACAAAGTCGATGATGAATCGAAATCAAAACTCGGCCTCATACTCATGGTT
TATGATCGACTGCTATTGACTGTTTTGATCGTGCTGAAGATTGTAGCTAGTCATTCAACGGCAGCGTCATTGACG
GCAGAGCGAGTCCAGATGGAGGATTTATTGACAGAAATGGCAAAGACAGTCATGTCCATCTTGTGCAAGCTGGGA
TCAAGCCCCATGACTCAGATGTACGAAGACCTCAAGCTAATACGACCTAGAGAGCGTGGAATTCGAGGCGATAGA
CCCTCTATTCATTCCTGGGTGTTGGTTATGAGGGTTTTAGACATTGCACACATGCCTCGGGCATCGTTTTGGGAC
GTGCTTCATGCAGTGATGGTGTCACCAGCTGTTGTTGCAAGTGGAGATGCAGCCCAGTATGAACGCTGCTGGGAA
CTCGTTTTTTCGCTTCTGCCTCTGACTCAGTTCAACAAGTGGGGAATTGTTGACGTTGGTGATGGCCGGCCGAGT
GCAGGACCGGAGGGCTGGACCATAGCTCAGAGCCTCCTCAAGACTGTCTTGTGCGCTTATCAAAGGAACAACCAC
CAGCCACCAAGCTTCAACAACTACTGTCGGGCTCTTGTTGCACGATGTTACTACCTAGTGCAGCATTGGGGCTGG
CGCAAGTCTGGCGGCGTGGTGGGAACAATATTTGATTTCTTTGGCTCACAAAACCTGGCGCATCTTCGCAATGAA
GAGGCAGACCAGTCGCCGAGGTTTATCGAGGAGCTTGCACGGCGACCAAAGCTGGACATTGAGCCGAGTGACCGA
TGCTTCCACATTTTCCTCAAGCTTGTTGCCCTCAGCATTGGCAAGATGGACGAAGCGGGAGCGGCCAAGGATATC
CGCAACTTGGTTGCTAGAATGATTCCAAATCACAACCGCCAGTACCTCAGAGACCAAGCTGTGCATGCCCGGGAG
TTGGCAGCCCTGAGGAACCACCACGATCTTCTTGGGACTCTGTTTTGGGCAGCTCCAGTGGAGATGCGGCCGGCG
GTAAGCCTCATGGAACGCCTTGTGGTGCCTGGAAACTCGCACAAAGCTGCGTGCCTTATTAATCTCCGGTGCTGG
CGGCAGCTCTCGCGCTTCATTGTGGCATCAGGAGAGGCATCGCGGACCCTGAGACCGTTGACGCGGTGGCGCGAC
ACCTTTTTCCAACAAGTCCTGGACCAGTTTCACTCGGTGGCTCCAGACGTTCAGCAGCAAGTGCTGGCGTATTCC
AGACAACTGGGAGAGCGCATTGGCGACCAAGTAGTCAATGAAACCATTTCACTCAACAAACGAAGCGTCATGGAC
ATATTGTACGCATCAGTCGAGTCGTCTTTGGATGTGATGCAGCATGCCCCCAATCTGGAGTCGGCTACCTTTTGT
TTCAACCCACTGCAGCTTCGGACAGTCTTTGAGCAAAGCCTTGACGGCACCTTGGGGCCAGATTGGGCCATGCTG
CGAGCATGCCTCGCCACGTTGGGCTCATTTCTCACCCATATTGAAACGTCCAAGGATAAGGAGGAAAGTCAACCG
GGCGAGTCTCAGGCTGGCACAAGCGACGACAAGGAGGAAAGCCAGCAGAGCGACTATCAAATCTCAAATTCTGTC
TTGGCCGACGATGCTTTGATGCAACTTGATCAAAACCTGGCCAATGTCTTTTTCTCGCTAGCCAGACGTGTTTTA
CTCATGCCAGGCGAACATGTGGAGACGGCCCAAGTGGAATGTTTGGACCAAATGGTGGTGCTGGCAGCAAGGATG
ACTTTACTCTTGGTCGATGCAGGCGTCTTGCGCCTCTGCGACATGTTTGGCCAGGGACGCTTTGGCTTGTTTGAC
GGGACACCTCACAAGCTTGATTTGCATCAACGCCGCTACCTGCATCTCTTTGTCTTGACAATGCTGCAGCGCGGG
TTCAACGACTGGACGGGCATAGACTTTGACCTGCTGGAACTATGGGTTTCTATCTTGGTACAGCCGCGAGACTGT
CTTGCCTACGAGACGAGTCTTGGCTCGGAATTATGGCGCAGAAGAGCCACCTTTGTTCCCGAGAGTGTCATGAGC
CTCGTAACCCGACCCGATTATCCCTCCAACGTGGCCTTGTTTGAATTCGCCGTGTCGGACATGCGGCAGCGGACC
CGCCTCGCGAGCAAATCGACACAGGGGACGCAAGCCACCAATGGCTCCAGGAACACACTAAAGCTCATGATGGAG
CAAATCAAGAGCGACTTGAAGACTCTGTCGGCAAACGATCCTCCGGAACATGGCAGCTATGTCAAATTTGTCCAG
GACATTATTTCTCTTGTAAAGTCGCATGGATCTGACATGTGTGCGATTGACGACTATTTTTACCAAATCAGCAAG
GAGTATGCACCAAGTGCCCAGGACCCTCAGCTTCAAGTGGCTAAGCTGGTCTCTTATGGACTGCGACTTGAAGAG
GGTGATGGCAAAGCCGCCCGGCCCTTGTTTTTCCTGCTCCTCAACAATGTCAAATCGGCCATGATGAAGGATGAG
CTGAGACGCGAAGTGGTTATGCTGTACAAGGGAATGCAAAATTGGGGTGTTGCGCAATTTGTGCTGAGCAAGATG
CTTCCAGCCATTATCTTGTCATGCCTCCGCAACAGCTCGGCCTTTCCATTGATGGACATTTATGCCAAGGCGCTA
CAGCTACTACTTGACCGACATGTCTTTTCTCATGAGCTCACCGAGCGAGACATGGACTGGGTGTGCATCTTGGTG
CGCGCTACCGTGCGAGGAATACACGACATGTTTGGGAGCAGACGTGTGCTGCTGTGTGCGTCGCAGGTGCACGTT
TTTGAGCAAGTTTTGGGTGTGCTAAATCTAATTTGGCCGTCTCTTGTTGCCTTGTCAATGACGGGGGCTTCATTT
GACAGCTTGACAGAGGTCTTGAGGAGTCTTGAGCACATGAGCACATTTGTCAGGGCAGCCAAGTCGGACTTGGAG
CAGGTGATGCAGGCAGGATCGGAAACAGTACATCTCGAGTGGCCACAGCCCTTGGCGATGCAAGAAGAGGTGCAG
CTGGACCACGAGGTGCAAGTGTTGGCGGATGATTTGGCTCAAGACGTGGAGAGGAATTGGAATATGACAAGTGAG
GCTATTTCGATACAGACACCGGGGAGAAGACATGGGCAGGATGTAGTGCTAGGGGCGCTGATGCCAGTGTGGGAC
ATGGGGAAAATGGTGCACGAGTTGCATGAGCGGGCCGAGGAGTGGTGTTGGCGTTGGTTGCAATTGACTGAGCAT
CATGTGGATGAGGTGGATGAGGTGGATGATGGGCCCAATGTGCTCGAGGCGTTTGTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail