Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2509
Gene name
LocationContig_18:124789..127258
Strand-
Gene length (bp)2469
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain 5.3E-27 594 688
PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain) 1.1E-18 65 149
PF00128 Alpha-amylase Alpha amylase, catalytic domain 2.3E-13 215 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gbeA PE=2 SV=1 16 690 0.0E+00
sp|Q9Y8H3|GLGB_EMENI 1,4-alpha-glucan-branching enzyme OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=be1 PE=2 SV=3 9 690 0.0E+00
sp|Q8NKE1|GLGB_RHIID 1,4-alpha-glucan-branching enzyme OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GLC3 PE=2 SV=2 19 687 0.0E+00
sp|P0CN82|GLGB_CRYNJ 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLC3 PE=3 SV=1 9 687 0.0E+00
sp|P0CN83|GLGB_CRYNB 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLC3 PE=3 SV=1 9 687 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gbeA PE=2 SV=1 16 690 0.0E+00
sp|Q9Y8H3|GLGB_EMENI 1,4-alpha-glucan-branching enzyme OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=be1 PE=2 SV=3 9 690 0.0E+00
sp|Q8NKE1|GLGB_RHIID 1,4-alpha-glucan-branching enzyme OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) GN=GLC3 PE=2 SV=2 19 687 0.0E+00
sp|P0CN82|GLGB_CRYNJ 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLC3 PE=3 SV=1 9 687 0.0E+00
sp|P0CN83|GLGB_CRYNB 1,4-alpha-glucan-branching enzyme OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLC3 PE=3 SV=1 9 687 0.0E+00
sp|Q6CCT1|GLGB_YARLI 1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLC3 PE=3 SV=1 20 690 0.0E+00
sp|Q6FJV0|GLGB_CANGA 1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLC3 PE=3 SV=1 19 689 0.0E+00
sp|Q6T308|GLGB_FELCA 1,4-alpha-glucan-branching enzyme OS=Felis catus GN=GBE1 PE=2 SV=1 1 690 0.0E+00
sp|Q9D6Y9|GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus GN=Gbe1 PE=1 SV=1 20 690 0.0E+00
sp|Q04446|GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens GN=GBE1 PE=1 SV=3 20 690 0.0E+00
sp|P32775|GLGB_YEAST 1,4-alpha-glucan-branching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC3 PE=1 SV=2 19 690 0.0E+00
sp|Q6EAS5|GLGB_HORSE 1,4-alpha-glucan-branching enzyme OS=Equus caballus GN=GBE1 PE=2 SV=1 1 690 0.0E+00
sp|Q757Q6|GLGB_ASHGO 1,4-alpha-glucan-branching enzyme OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLC3 PE=3 SV=1 19 688 0.0E+00
sp|Q6CX53|GLGB_KLULA 1,4-alpha-glucan-branching enzyme OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLC3 PE=3 SV=1 19 692 0.0E+00
sp|Q6BXN1|GLGB_DEBHA 1,4-alpha-glucan-branching enzyme OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLC3 PE=3 SV=1 19 692 0.0E+00
sp|Q555Q9|GLGB_DICDI 1,4-alpha-glucan-branching enzyme OS=Dictyostelium discoideum GN=glgB PE=3 SV=1 13 690 0.0E+00
sp|Q9LZS3|GLGB2_ARATH 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.2 PE=2 SV=1 16 687 0.0E+00
sp|O23647|GLGB1_ARATH 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE2.1 PE=2 SV=1 1 682 0.0E+00
sp|Q41058|GLGB1_PEA 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic OS=Pisum sativum GN=SBEI PE=1 SV=1 17 692 0.0E+00
sp|P30924|GLGB_SOLTU 1,4-alpha-glucan-branching enzyme OS=Solanum tuberosum GN=SBE1 PE=2 SV=2 9 685 0.0E+00
sp|Q01401|GLGB_ORYSJ 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=SBE1 PE=1 SV=2 20 690 0.0E+00
sp|Q08047|GLGB_MAIZE 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic OS=Zea mays GN=SBE1 PE=1 SV=1 15 687 0.0E+00
sp|Q41059|GLGB2_PEA 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic (Fragment) OS=Pisum sativum GN=SBEII PE=1 SV=1 16 690 0.0E+00
sp|D2WL32|GLGB3_ARATH 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SBE3 PE=1 SV=1 122 685 3.0E-154
sp|Q8CZE8|GLGB_OCEIH 1,4-alpha-glucan branching enzyme GlgB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glgB PE=3 SV=1 69 689 3.0E-65
sp|Q24VW3|GLGB_DESHY 1,4-alpha-glucan branching enzyme GlgB OS=Desulfitobacterium hafniense (strain Y51) GN=glgB PE=3 SV=1 80 689 3.0E-61
sp|Q608L5|GLGB_METCA 1,4-alpha-glucan branching enzyme GlgB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glgB PE=3 SV=1 68 687 7.0E-59
sp|Q9KNE8|GLGB_VIBCH 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glgB PE=3 SV=1 63 652 4.0E-58
sp|Q3JCN0|GLGB_NITOC 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=glgB PE=3 SV=1 69 694 3.0E-56
sp|A2BVP7|GLGB_PROM5 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9515) GN=glgB PE=3 SV=1 17 653 8.0E-56
sp|Q6LHN1|GLGB_PHOPR 1,4-alpha-glucan branching enzyme GlgB OS=Photobacterium profundum GN=glgB PE=3 SV=1 75 687 1.0E-55
sp|A2BQ65|GLGB_PROMS 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain AS9601) GN=glgB PE=3 SV=1 71 653 2.0E-55
sp|A3PBV8|GLGB_PROM0 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9301) GN=glgB PE=3 SV=1 71 653 2.0E-55
sp|Q21M30|GLGB_SACD2 1,4-alpha-glucan branching enzyme GlgB OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=glgB PE=3 SV=1 80 686 2.0E-55
sp|Q3SH78|GLGB_THIDA 1,4-alpha-glucan branching enzyme GlgB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=glgB PE=3 SV=1 68 686 3.0E-55
sp|O66936|GLGB_AQUAE 1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) GN=glgB PE=3 SV=1 69 689 3.0E-55
sp|Q31BV0|GLGB_PROM9 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9312) GN=glgB PE=3 SV=1 71 653 3.0E-55
sp|Q5DZB8|GLGB_VIBF1 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glgB PE=3 SV=1 75 652 4.0E-55
sp|Q7VBL4|GLGB_PROMA 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=glgB PE=3 SV=1 75 686 5.0E-55
sp|Q47II8|GLGB_DECAR 1,4-alpha-glucan branching enzyme GlgB OS=Dechloromonas aromatica (strain RCB) GN=glgB PE=3 SV=1 76 689 6.0E-55
sp|Q3AYE2|GLGB_SYNS9 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9902) GN=glgB PE=3 SV=1 68 650 8.0E-55
sp|A2C142|GLGB_PROM1 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain NATL1A) GN=glgB PE=3 SV=1 69 650 1.0E-54
sp|Q8D4P0|GLGB_VIBVU 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain CMCP6) GN=glgB PE=3 SV=1 63 650 2.0E-54
sp|Q7MG90|GLGB_VIBVY 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio vulnificus (strain YJ016) GN=glgB PE=3 SV=2 63 650 2.0E-54
sp|Q46LW6|GLGB_PROMT 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain NATL2A) GN=glgB PE=3 SV=1 69 650 2.0E-54
sp|A8G3V0|GLGB_PROM2 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9215) GN=glgB PE=3 SV=1 71 653 4.0E-54
sp|Q7V299|GLGB_PROMP 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=glgB PE=3 SV=1 71 653 4.0E-54
sp|Q1AZ86|GLGB_RUBXD 1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=glgB PE=3 SV=1 80 686 5.0E-54
sp|B8CVY1|GLGB_HALOH 1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=glgB PE=3 SV=1 70 686 1.0E-53
sp|Q8DLB8|GLGB_THEEB 1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus elongatus (strain BP-1) GN=glgB PE=3 SV=1 51 650 2.0E-53
sp|Q5N4W5|GLGB_SYNP6 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=glgB PE=3 SV=1 69 691 2.0E-53
sp|P16954|GLGB_SYNE7 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus elongatus (strain PCC 7942) GN=glgB PE=1 SV=2 69 691 2.0E-53
sp|A9BAY7|GLGB_PROM4 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9211) GN=glgB PE=3 SV=1 75 650 2.0E-53
sp|Q2T6R3|GLGB_BURTA 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glgB PE=3 SV=1 80 647 4.0E-53
sp|Q1D654|GLGB_MYXXD 1,4-alpha-glucan branching enzyme GlgB OS=Myxococcus xanthus (strain DK 1622) GN=glgB PE=3 SV=1 80 684 4.0E-53
sp|A6WKY2|GLGB_SHEB8 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS185) GN=glgB PE=3 SV=1 80 694 4.0E-53
sp|Q81ZU6|GLGB_NITEU 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=glgB PE=3 SV=1 15 691 4.0E-53
sp|A9KTJ1|GLGB_SHEB9 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS195) GN=glgB PE=3 SV=1 80 694 4.0E-53
sp|A3D286|GLGB_SHEB5 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glgB PE=3 SV=1 80 694 5.0E-53
sp|Q4JUK5|GLGB_CORJK 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium jeikeium (strain K411) GN=glgB PE=3 SV=1 75 683 5.0E-53
sp|Q87FR0|GLGB_VIBPA 1,4-alpha-glucan branching enzyme GlgB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glgB PE=3 SV=1 63 652 5.0E-53
sp|Q2RR72|GLGB_RHORT 1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glgB PE=3 SV=1 80 650 6.0E-53
sp|Q11EX1|GLGB_CHESB 1,4-alpha-glucan branching enzyme GlgB OS=Chelativorans sp. (strain BNC1) GN=glgB PE=3 SV=1 80 689 6.0E-53
sp|Q5Z0W8|GLGB_NOCFA 1,4-alpha-glucan branching enzyme GlgB OS=Nocardia farcinica (strain IFM 10152) GN=glgB PE=3 SV=1 80 687 8.0E-53
sp|B8EAX1|GLGB_SHEB2 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS223) GN=glgB PE=3 SV=1 80 694 1.0E-52
sp|Q7U646|GLGB_SYNPX 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain WH8102) GN=glgB PE=3 SV=1 63 650 1.0E-52
sp|P52981|GLGB_SYNY3 1,4-alpha-glucan branching enzyme GlgB OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glgB PE=1 SV=1 69 650 3.0E-52
sp|Q6L2Z9|GLGB_PICTO 1,4-alpha-glucan branching enzyme GlgB OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=glgB PE=3 SV=1 80 690 4.0E-52
sp|Q2YB47|GLGB_NITMU 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glgB PE=3 SV=1 75 652 4.0E-52
sp|Q0AGJ0|GLGB_NITEC 1,4-alpha-glucan branching enzyme GlgB OS=Nitrosomonas eutropha (strain C91) GN=glgB PE=3 SV=1 80 686 5.0E-52
sp|Q8PDD1|GLGB2_XANCP 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glgB2 PE=3 SV=1 68 689 1.0E-51
sp|Q4UZL7|GLGB2_XANC8 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glgB2 PE=3 SV=1 68 689 1.0E-51
sp|A1KIB6|GLGB_MYCBP 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=glgB PE=3 SV=1 75 686 3.0E-51
sp|P59816|GLGB_MYCBO 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgB PE=3 SV=1 75 686 3.0E-51
sp|Q2W2Q6|GLGB_MAGSA 1,4-alpha-glucan branching enzyme GlgB OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glgB PE=3 SV=1 80 689 4.0E-51
sp|Q5NXV7|GLGB_AROAE 1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) GN=glgB PE=3 SV=1 80 645 5.0E-51
sp|Q73X75|GLGB_MYCPA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glgB PE=3 SV=1 75 686 5.0E-51
sp|A5GJR7|GLGB_SYNPW 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain WH7803) GN=glgB PE=3 SV=1 75 650 6.0E-51
sp|Q8YYX9|GLGB_NOSS1 1,4-alpha-glucan branching enzyme GlgB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glgB PE=3 SV=1 75 650 9.0E-51
sp|Q081Q4|GLGB_SHEFN 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella frigidimarina (strain NCIMB 400) GN=glgB PE=3 SV=1 80 679 1.0E-50
sp|A2CAR9|GLGB_PROM3 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9303) GN=glgB PE=3 SV=1 75 650 1.0E-50
sp|Q31IB6|GLGB_THICR 1,4-alpha-glucan branching enzyme GlgB OS=Thiomicrospira crunogena (strain XCL-2) GN=glgB PE=3 SV=1 69 686 1.0E-50
sp|Q3M473|GLGB_ANAVT 1,4-alpha-glucan branching enzyme GlgB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glgB PE=3 SV=1 58 650 1.0E-50
sp|P9WN44|GLGB_MYCTO 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgB PE=3 SV=1 75 686 2.0E-50
sp|Q7V8B5|GLGB_PROMM 1,4-alpha-glucan branching enzyme GlgB OS=Prochlorococcus marinus (strain MIT 9313) GN=glgB PE=3 SV=1 75 650 3.0E-50
sp|Q3AKV6|GLGB_SYNSC 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9605) GN=glgB PE=3 SV=1 75 650 4.0E-50
sp|A5EPZ7|GLGB_BRASB 1,4-alpha-glucan branching enzyme GlgB OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=glgB PE=3 SV=1 81 650 4.0E-50
sp|P9WN45|GLGB_MYCTU 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgB PE=1 SV=1 75 686 6.0E-50
sp|A5U226|GLGB_MYCTA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=glgB PE=3 SV=1 75 686 6.0E-50
sp|A5GSG4|GLGB_SYNR3 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain RCC307) GN=glgB PE=3 SV=1 80 660 6.0E-50
sp|Q47SE7|GLGB_THEFY 1,4-alpha-glucan branching enzyme GlgB OS=Thermobifida fusca (strain YX) GN=glgB PE=3 SV=1 63 650 7.0E-50
sp|Q2JZ21|GLGB2_RHIEC 1,4-alpha-glucan branching enzyme GlgB 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glgB2 PE=3 SV=1 69 686 7.0E-50
sp|Q5H6H2|GLGB1_XANOR 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glgB1 PE=3 SV=1 80 650 7.0E-50
sp|A0PUI6|GLGB_MYCUA 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium ulcerans (strain Agy99) GN=glgB PE=3 SV=1 75 686 8.0E-50
sp|Q1QNB1|GLGB_NITHX 1,4-alpha-glucan branching enzyme GlgB OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glgB PE=3 SV=1 81 650 8.0E-50
sp|Q6NHR6|GLGB_CORDI 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=glgB PE=3 SV=1 80 683 1.0E-49
sp|Q8PQA2|GLGB2_XANAC 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glgB2 PE=3 SV=1 42 689 2.0E-49
sp|Q114I1|GLGB_TRIEI 1,4-alpha-glucan branching enzyme GlgB OS=Trichodesmium erythraeum (strain IMS101) GN=glgB PE=3 SV=1 69 650 2.0E-49
sp|Q2P949|GLGB2_XANOM 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glgB2 PE=3 SV=1 80 650 3.0E-49
sp|Q2JT08|GLGB_SYNJA 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-3-3Ab) GN=glgB PE=3 SV=1 27 650 3.0E-49
sp|Q65TI0|GLGB_MANSM 1,4-alpha-glucan branching enzyme GlgB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=glgB PE=3 SV=1 37 686 3.0E-49
sp|Q8PR13|GLGB1_XANAC 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glgB1 PE=3 SV=1 80 645 5.0E-49
sp|Q2S4A0|GLGB_SALRD 1,4-alpha-glucan branching enzyme GlgB OS=Salinibacter ruber (strain DSM 13855 / M31) GN=glgB PE=3 SV=1 63 686 5.0E-49
sp|Q3J3M6|GLGB_RHOS4 1,4-alpha-glucan branching enzyme GlgB OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=glgB PE=3 SV=1 75 679 7.0E-49
sp|Q9RTB7|GLGB_DEIRA 1,4-alpha-glucan branching enzyme GlgB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glgB PE=3 SV=1 40 651 1.0E-48
sp|A3PIQ5|GLGB_RHOS1 1,4-alpha-glucan branching enzyme GlgB OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=glgB PE=3 SV=1 75 679 1.0E-48
sp|Q6CZK0|GLGB_PECAS 1,4-alpha-glucan branching enzyme GlgB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glgB PE=3 SV=1 80 689 1.0E-48
sp|Q15VD0|GLGB_PSEA6 1,4-alpha-glucan branching enzyme GlgB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glgB PE=3 SV=1 61 688 1.0E-48
sp|Q0SGR9|GLGB_RHOJR 1,4-alpha-glucan branching enzyme GlgB OS=Rhodococcus jostii (strain RHA1) GN=glgB PE=3 SV=1 80 689 2.0E-48
sp|Q985P4|GLGB_RHILO 1,4-alpha-glucan branching enzyme GlgB OS=Rhizobium loti (strain MAFF303099) GN=glgB PE=3 SV=1 80 647 2.0E-48
sp|Q1M3A7|GLGB2_RHIL3 1,4-alpha-glucan branching enzyme GlgB 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=glgB2 PE=3 SV=1 51 686 2.0E-48
sp|Q2IYX0|GLGB_RHOP2 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain HaA2) GN=glgB PE=3 SV=1 81 650 3.0E-48
sp|Q1WSM8|GLGB_LACS1 1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus salivarius (strain UCC118) GN=glgB PE=3 SV=1 76 650 3.0E-48
sp|Q3STC2|GLGB_NITWN 1,4-alpha-glucan branching enzyme GlgB OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=glgB PE=3 SV=1 81 650 3.0E-48
sp|Q0I8Y2|GLGB_SYNS3 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain CC9311) GN=glgB PE=3 SV=1 75 645 3.0E-48
sp|Q3BZE1|GLGB1_XANC5 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glgB1 PE=3 SV=1 80 645 4.0E-48
sp|Q7NL20|GLGB_GLOVI 1,4-alpha-glucan branching enzyme GlgB OS=Gloeobacter violaceus (strain PCC 7421) GN=glgB PE=3 SV=1 75 653 5.0E-48
sp|A0Q593|GLGB_FRATN 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. novicida (strain U112) GN=glgB PE=3 SV=1 75 686 5.0E-48
sp|A9VMV8|GLGB_BACWK 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus weihenstephanensis (strain KBAB4) GN=glgB PE=3 SV=1 80 679 6.0E-48
sp|Q2JK68|GLGB_SYNJB 1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=glgB PE=3 SV=1 27 650 6.0E-48
sp|Q2P9F7|GLGB1_XANOM 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glgB1 PE=3 SV=1 75 689 6.0E-48
sp|Q3BYI0|GLGB2_XANC5 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glgB2 PE=3 SV=1 42 689 7.0E-48
sp|A6V628|GLGB_PSEA7 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas aeruginosa (strain PA7) GN=glgB PE=3 SV=1 75 686 8.0E-48
sp|Q5H6Q3|GLGB2_XANOR 1,4-alpha-glucan branching enzyme GlgB 2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glgB2 PE=3 SV=2 42 689 8.0E-48
sp|Q210H1|GLGB_RHOPB 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain BisB18) GN=glgB PE=3 SV=1 67 650 8.0E-48
sp|B7IM37|GLGB_BACC2 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain G9842) GN=glgB PE=3 SV=1 46 679 9.0E-48
sp|Q1IZQ3|GLGB_DEIGD 1,4-alpha-glucan branching enzyme GlgB OS=Deinococcus geothermalis (strain DSM 11300) GN=glgB PE=3 SV=1 40 686 1.0E-47
sp|A4TQV2|GLGB_YERPP 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis (strain Pestoides F) GN=glgB PE=3 SV=1 44 645 1.0E-47
sp|Q1CDL3|GLGB_YERPN 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glgB PE=3 SV=1 44 645 1.0E-47
sp|Q8ZA75|GLGB_YERPE 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis GN=glgB PE=3 SV=1 44 645 1.0E-47
sp|Q1C1D9|GLGB_YERPA 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glgB PE=3 SV=1 44 645 1.0E-47
sp|Q664I2|GLGB_YERPS 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glgB PE=3 SV=1 44 645 1.0E-47
sp|A8GKV0|GLGB_SERP5 1,4-alpha-glucan branching enzyme GlgB OS=Serratia proteamaculans (strain 568) GN=glgB PE=3 SV=1 44 689 1.0E-47
sp|Q816G6|GLGB_BACCR 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glgB PE=3 SV=1 46 679 1.0E-47
sp|Q81K82|GLGB_BACAN 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis GN=glgB PE=3 SV=1 46 679 2.0E-47
sp|C3LC26|GLGB_BACAC 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glgB PE=3 SV=1 46 679 2.0E-47
sp|C3PCL8|GLGB_BACAA 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain A0248) GN=glgB PE=3 SV=1 46 679 2.0E-47
sp|P30538|GLGB_GEOSE 1,4-alpha-glucan branching enzyme GlgB OS=Geobacillus stearothermophilus GN=glgB PE=1 SV=1 60 657 2.0E-47
sp|B3PGN4|GLGB_CELJU 1,4-alpha-glucan branching enzyme GlgB OS=Cellvibrio japonicus (strain Ueda107) GN=glgB PE=3 SV=1 68 667 2.0E-47
sp|Q133N2|GLGB_RHOPS 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain BisB5) GN=glgB PE=3 SV=1 73 650 2.0E-47
sp|Q8PE48|GLGB1_XANCP 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glgB1 PE=3 SV=1 80 645 2.0E-47
sp|Q4V0E2|GLGB1_XANC8 1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glgB1 PE=3 SV=1 80 645 2.0E-47
sp|Q39N89|GLGB_BURL3 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=glgB PE=3 SV=1 32 650 2.0E-47
sp|B7HBC7|GLGB_BACC4 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain B4264) GN=glgB PE=3 SV=1 46 679 2.0E-47
sp|A7FNX5|GLGB_YERP3 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glgB PE=3 SV=1 75 645 2.0E-47
sp|A4Z005|GLGB_BRASO 1,4-alpha-glucan branching enzyme GlgB OS=Bradyrhizobium sp. (strain ORS278) GN=glgB PE=3 SV=1 81 650 3.0E-47
sp|Q6HC15|GLGB_BACHK 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glgB PE=3 SV=1 46 679 3.0E-47
sp|Q72YJ3|GLGB_BACC1 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glgB PE=3 SV=1 46 657 3.0E-47
sp|B7JDF1|GLGB_BACC0 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain AH820) GN=glgB PE=3 SV=1 46 679 3.0E-47
sp|B9J2G8|GLGB_BACCQ 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain Q1) GN=glgB PE=3 SV=1 46 657 4.0E-47
sp|Q632H1|GLGB_BACCZ 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ZK / E33L) GN=glgB PE=3 SV=1 56 657 4.0E-47
sp|Q93HU3|GLGB_RHOMR 1,4-alpha-glucan branching enzyme GlgB OS=Rhodothermus marinus GN=glgB PE=3 SV=1 80 691 5.0E-47
sp|B7HTX9|GLGB_BACC7 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain AH187) GN=glgB PE=3 SV=1 46 657 5.0E-47
sp|C1EX54|GLGB_BACC3 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain 03BB102) GN=glgB PE=3 SV=1 46 679 5.0E-47
sp|Q9RQI5|GLGB_BERDE 1,4-alpha-glucan branching enzyme GlgB OS=Bergeriella denitrificans GN=glgB PE=3 SV=1 80 650 5.0E-47
sp|Q8EGU7|GLGB_SHEON 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella oneidensis (strain MR-1) GN=glgB PE=3 SV=2 68 687 5.0E-47
sp|Q0BN67|GLGB_FRATO 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=glgB PE=3 SV=1 75 686 7.0E-47
sp|A7NAI2|GLGB_FRATF 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=glgB PE=3 SV=1 75 686 7.0E-47
sp|Q9I1W2|GLGB_PSEAE 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glgB PE=3 SV=1 75 650 7.0E-47
sp|Q07K87|GLGB_RHOP5 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain BisA53) GN=glgB PE=3 SV=1 81 650 9.0E-47
sp|Q2A4U7|GLGB_FRATH 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. holarctica (strain LVS) GN=glgB PE=3 SV=1 75 686 1.0E-46
sp|Q6AEU4|GLGB_LEIXX 1,4-alpha-glucan branching enzyme GlgB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glgB PE=3 SV=1 80 686 1.0E-46
sp|Q0HGI8|GLGB_SHESM 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain MR-4) GN=glgB PE=3 SV=1 68 687 1.0E-46
sp|A4IZK2|GLGB_FRATW 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=glgB PE=3 SV=1 75 686 1.0E-46
sp|P30537|GLGB_BACCL 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus caldolyticus GN=glgB PE=1 SV=1 80 657 2.0E-46
sp|Q0HST5|GLGB_SHESR 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain MR-7) GN=glgB PE=3 SV=1 27 687 2.0E-46
sp|A1JSJ0|GLGB_YERE8 1,4-alpha-glucan branching enzyme GlgB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glgB PE=3 SV=1 63 645 3.0E-46
sp|B0BT96|GLGB_ACTPJ 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glgB PE=3 SV=1 80 687 4.0E-46
sp|A3MZ64|GLGB_ACTP2 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glgB PE=3 SV=1 80 687 4.0E-46
sp|P52980|GLGB_STRAU 1,4-alpha-glucan branching enzyme GlgB OS=Streptomyces aureofaciens GN=glgB PE=3 SV=1 80 650 5.0E-46
sp|Q1H1K2|GLGB_METFK 1,4-alpha-glucan branching enzyme GlgB OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=glgB PE=3 SV=1 80 645 5.0E-46
sp|B2SFM7|GLGB_FRATM 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=glgB PE=3 SV=1 75 686 5.0E-46
sp|A1U0K1|GLGB_MARHV 1,4-alpha-glucan branching enzyme GlgB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=glgB PE=3 SV=1 80 688 5.0E-46
sp|Q89FD3|GLGB_BRADU 1,4-alpha-glucan branching enzyme GlgB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glgB PE=3 SV=1 81 650 6.0E-46
sp|A6VP15|GLGB_ACTSZ 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glgB PE=3 SV=1 75 645 6.0E-46
sp|Q8RF62|GLGB_FUSNN 1,4-alpha-glucan branching enzyme GlgB OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glgB PE=3 SV=1 57 686 7.0E-46
sp|B3H0J1|GLGB_ACTP7 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glgB PE=3 SV=1 80 687 7.0E-46
sp|A0R1Y4|GLGB_MYCS2 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glgB PE=3 SV=1 75 684 9.0E-46
sp|Q8XT76|GLGB_RALSO 1,4-alpha-glucan branching enzyme GlgB OS=Ralstonia solanacearum (strain GMI1000) GN=glgB PE=3 SV=1 75 650 1.0E-45
sp|Q729V5|GLGB_DESVH 1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=glgB PE=3 SV=1 80 691 1.0E-45
sp|Q46TF2|GLGB_CUPPJ 1,4-alpha-glucan branching enzyme GlgB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=glgB PE=3 SV=1 68 686 1.0E-45
sp|A1RLX8|GLGB_SHESW 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella sp. (strain W3-18-1) GN=glgB PE=3 SV=1 80 687 1.0E-45
sp|P30539|GLGB_BUTFI 1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens GN=glgB PE=1 SV=1 72 429 1.0E-45
sp|Q6N3P9|GLGB_RHOPA 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glgB PE=3 SV=1 81 650 2.0E-45
sp|A4Y4U3|GLGB_SHEPC 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=glgB PE=3 SV=1 80 687 2.0E-45
sp|Q1B568|GLGB_MYCSS 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium sp. (strain MCS) GN=glgB PE=3 SV=1 75 684 2.0E-45
sp|A1UJW9|GLGB_MYCSK 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium sp. (strain KMS) GN=glgB PE=3 SV=1 75 684 2.0E-45
sp|P39118|GLGB_BACSU 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus subtilis (strain 168) GN=glgB PE=2 SV=1 69 657 2.0E-45
sp|P45177|GLGB_HAEIN 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glgB PE=3 SV=1 75 686 2.0E-45
sp|B0TZI5|GLGB_FRAP2 1,4-alpha-glucan branching enzyme GlgB OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=glgB PE=3 SV=1 75 686 2.0E-45
sp|A1VC54|GLGB_DESVV 1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=glgB PE=3 SV=1 80 691 3.0E-45
sp|Q881X0|GLGB_PSESM 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glgB PE=3 SV=1 68 650 3.0E-45
sp|Q4KCQ3|GLGB_PSEF5 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glgB PE=3 SV=1 68 650 3.0E-45
sp|A0KDG4|GLGB_BURCH 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia cenocepacia (strain HI2424) GN=glgB PE=3 SV=1 68 650 3.0E-45
sp|Q1BVW7|GLGB_BURCA 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia cenocepacia (strain AU 1054) GN=glgB PE=3 SV=1 68 650 4.0E-45
sp|Q9CN94|GLGB_PASMU 1,4-alpha-glucan branching enzyme GlgB OS=Pasteurella multocida (strain Pm70) GN=glgB PE=3 SV=1 75 654 4.0E-45
sp|Q4ZTJ2|GLGB_PSEU2 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glgB PE=3 SV=1 68 650 4.0E-45
sp|Q5NHN4|GLGB_FRATT 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glgB PE=3 SV=1 75 686 4.0E-45
sp|Q14J36|GLGB_FRAT1 1,4-alpha-glucan branching enzyme GlgB OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=glgB PE=3 SV=1 75 686 4.0E-45
sp|A5UEJ2|GLGB_HAEIG 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain PittGG) GN=glgB PE=3 SV=1 75 686 4.0E-45
sp|A3Q396|GLGB_MYCSJ 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium sp. (strain JLS) GN=glgB PE=3 SV=1 75 684 5.0E-45
sp|Q48IE2|GLGB_PSE14 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glgB PE=3 SV=1 68 650 5.0E-45
sp|A7GUA1|GLGB_BACCN 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glgB PE=3 SV=1 80 679 5.0E-45
sp|Q3KD78|GLGB_PSEPF 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain Pf0-1) GN=glgB PE=3 SV=1 68 689 6.0E-45
sp|Q8G5L0|GLGB_BIFLO 1,4-alpha-glucan branching enzyme GlgB OS=Bifidobacterium longum (strain NCC 2705) GN=glgB PE=3 SV=1 80 690 6.0E-45
sp|Q5FL68|GLGB_LACAC 1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glgB PE=3 SV=1 55 690 1.0E-44
sp|Q4QK67|GLGB_HAEI8 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain 86-028NP) GN=glgB PE=3 SV=1 75 686 1.0E-44
sp|Q8NR40|GLGB_CORGL 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glgB PE=3 SV=1 80 429 1.0E-44
sp|Q2G7S5|GLGB_NOVAD 1,4-alpha-glucan branching enzyme GlgB OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=glgB PE=3 SV=1 80 650 2.0E-44
sp|Q7UVH1|GLGB_RHOBA 1,4-alpha-glucan branching enzyme GlgB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glgB PE=3 SV=1 63 689 2.0E-44
sp|Q8FQ12|GLGB_COREF 1,4-alpha-glucan branching enzyme GlgB OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glgB PE=3 SV=1 80 650 3.0E-44
sp|Q9PL51|GLGB_CHLMU 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia muridarum (strain MoPn / Nigg) GN=glgB PE=3 SV=1 80 429 3.0E-44
sp|Q890J1|GLGB_LACPL 1,4-alpha-glucan branching enzyme GlgB OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glgB PE=3 SV=1 65 686 4.0E-44
sp|Q0AA26|GLGB_ALKEH 1,4-alpha-glucan branching enzyme GlgB OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=glgB PE=3 SV=1 75 691 5.0E-44
sp|A4JR39|GLGB_BURVG 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=glgB PE=3 SV=1 67 650 6.0E-44
sp|Q30Z14|GLGB_DESAG 1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio alaskensis (strain G20) GN=glgB PE=3 SV=1 80 645 6.0E-44
sp|Q253M6|GLGB_CHLFF 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydophila felis (strain Fe/C-56) GN=glgB PE=3 SV=1 63 429 7.0E-44
sp|Q0SWZ1|GLGB1_CLOPS 1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain SM101 / Type A) GN=glgB1 PE=3 SV=1 70 650 9.0E-44
sp|Q8E5V8|GLGB_STRA3 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glgB PE=3 SV=1 69 650 9.0E-44
sp|Q0I3H7|GLGB_HAES1 1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus somnus (strain 129Pt) GN=glgB PE=3 SV=1 70 686 1.0E-43
sp|Q8XK15|GLGB2_CLOPE 1,4-alpha-glucan branching enzyme GlgB 2 OS=Clostridium perfringens (strain 13 / Type A) GN=glgB2 PE=3 SV=1 70 654 1.0E-43
sp|Q2K487|GLGB1_RHIEC 1,4-alpha-glucan branching enzyme GlgB 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glgB1 PE=3 SV=1 75 645 1.0E-43
sp|Q8XPA2|GLGB1_CLOPE 1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain 13 / Type A) GN=glgB1 PE=3 SV=1 70 650 1.0E-43
sp|B0B998|GLGB_CHLT2 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=glgB PE=3 SV=1 80 429 1.0E-43
sp|A4WFL5|GLGB_ENT38 1,4-alpha-glucan branching enzyme GlgB OS=Enterobacter sp. (strain 638) GN=glgB PE=3 SV=1 80 689 2.0E-43
sp|B0BAX7|GLGB_CHLTB 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=glgB PE=3 SV=1 80 429 2.0E-43
sp|Q0TQ16|GLGB_CLOP1 1,4-alpha-glucan branching enzyme GlgB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glgB PE=3 SV=1 70 654 2.0E-43
sp|Q21WG7|GLGB_RHOFT 1,4-alpha-glucan branching enzyme GlgB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=glgB PE=3 SV=1 64 686 2.0E-43
sp|Q8E081|GLGB_STRA5 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glgB PE=3 SV=1 75 650 2.0E-43
sp|Q3K1K5|GLGB_STRA1 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glgB PE=3 SV=1 75 650 2.0E-43
sp|P52979|GLGB_RHIRD 1,4-alpha-glucan branching enzyme GlgB OS=Rhizobium radiobacter GN=glgB PE=3 SV=2 45 430 2.0E-43
sp|B0UU89|GLGB_HISS2 1,4-alpha-glucan branching enzyme GlgB OS=Histophilus somni (strain 2336) GN=glgB PE=3 SV=1 70 686 2.0E-43
sp|Q0BU54|GLGB_GRABC 1,4-alpha-glucan branching enzyme GlgB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=glgB PE=3 SV=1 75 645 2.0E-43
sp|O84874|GLGB_CHLTR 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glgB PE=3 SV=1 80 429 3.0E-43
sp|Q3KKH0|GLGB_CHLTA 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=glgB PE=3 SV=1 80 429 5.0E-43
sp|Q31VJ1|GLGB_SHIBS 1,4-alpha-glucan branching enzyme GlgB OS=Shigella boydii serotype 4 (strain Sb227) GN=glgB PE=3 SV=1 80 689 5.0E-43
sp|Q59832|GLGB2_STRCO 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB2 PE=3 SV=2 80 650 5.0E-43
sp|A9MMA0|GLGB_SALAR 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glgB PE=3 SV=1 80 689 8.0E-43
sp|Q0SSN2|GLGB2_CLOPS 1,4-alpha-glucan branching enzyme GlgB 2 OS=Clostridium perfringens (strain SM101 / Type A) GN=glgB2 PE=3 SV=1 70 654 8.0E-43
sp|Q32AV3|GLGB_SHIDS 1,4-alpha-glucan branching enzyme GlgB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glgB PE=3 SV=1 80 689 1.0E-42
sp|Q0K0X8|GLGB_CUPNH 1,4-alpha-glucan branching enzyme GlgB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glgB PE=3 SV=1 69 650 1.0E-42
sp|A3N8B3|GLGB_BURP6 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain 668) GN=glgB PE=3 SV=1 52 652 1.0E-42
sp|Q0SZN2|GLGB_SHIF8 1,4-alpha-glucan branching enzyme GlgB OS=Shigella flexneri serotype 5b (strain 8401) GN=glgB PE=3 SV=1 80 689 1.0E-42
sp|Q2J6Q9|GLGB_FRASC 1,4-alpha-glucan branching enzyme GlgB OS=Frankia sp. (strain CcI3) GN=glgB PE=3 SV=1 75 650 1.0E-42
sp|Q8Z235|GLGB_SALTI 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella typhi GN=glgB PE=3 SV=1 80 689 1.0E-42
sp|Q57IT8|GLGB_SALCH 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella choleraesuis (strain SC-B67) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|Q3JTG5|GLGB_BURP1 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain 1710b) GN=glgB PE=3 SV=1 52 652 2.0E-42
sp|A3NU16|GLGB_BURP0 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain 1106a) GN=glgB PE=3 SV=1 52 652 2.0E-42
sp|Q8ZLG5|GLGB_SALTY 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|Q8FCR7|GLGB_ECOL6 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|Q5PM06|GLGB_SALPA 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|Q5L6K4|GLGB_CHLAB 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=glgB PE=3 SV=1 67 425 2.0E-42
sp|Q83PV3|GLGB_SHIFL 1,4-alpha-glucan branching enzyme GlgB OS=Shigella flexneri GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|Q63T91|GLGB_BURPS 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain K96243) GN=glgB PE=3 SV=1 52 652 2.0E-42
sp|Q3YW93|GLGB_SHISS 1,4-alpha-glucan branching enzyme GlgB OS=Shigella sonnei (strain Ss046) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|P07762|GLGB_ECOLI 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain K12) GN=glgB PE=1 SV=1 80 689 2.0E-42
sp|B1IP32|GLGB_ECOLC 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|A8A5P2|GLGB_ECOHS 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O9:H4 (strain HS) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|A7ZSW5|GLGB_ECO24 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glgB PE=3 SV=1 80 689 2.0E-42
sp|Q65FS4|GLGB_BACLD 1,4-alpha-glucan branching enzyme GlgB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glgB PE=3 SV=1 80 657 3.0E-42
sp|Q8X6X6|GLGB_ECO57 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O157:H7 GN=glgB PE=3 SV=1 80 689 3.0E-42
sp|Q28MN2|GLGB_JANSC 1,4-alpha-glucan branching enzyme GlgB OS=Jannaschia sp. (strain CCS1) GN=glgB PE=3 SV=2 80 690 3.0E-42
sp|Q825Q8|GLGB2_STRAW 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB2 PE=3 SV=1 80 654 4.0E-42
sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas putida (strain KT2440) GN=glgB PE=3 SV=1 64 429 4.0E-42
sp|A9MTV4|GLGB_SALPB 1,4-alpha-glucan branching enzyme GlgB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glgB PE=3 SV=1 80 689 4.0E-42
sp|Q8DPS6|GLGB_STRR6 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgB PE=3 SV=1 69 650 5.0E-42
sp|Q04KG8|GLGB_STRP2 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgB PE=3 SV=1 69 650 5.0E-42
sp|Q0TC27|GLGB_ECOL5 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glgB PE=3 SV=1 80 689 5.0E-42
sp|Q1R5J4|GLGB_ECOUT 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain UTI89 / UPEC) GN=glgB PE=3 SV=1 80 689 7.0E-42
sp|A1AGW5|GLGB_ECOK1 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O1:K1 / APEC GN=glgB PE=3 SV=1 80 689 7.0E-42
sp|Q82JF0|GLGB1_STRAW 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB1 PE=3 SV=1 80 686 1.0E-41
sp|Q97QS8|GLGB_STRPN 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glgB PE=3 SV=1 69 650 1.0E-41
sp|Q8GQC5|GLGB_DICCH 1,4-alpha-glucan branching enzyme GlgB OS=Dickeya chrysanthemi GN=glgB PE=1 SV=1 80 645 2.0E-41
sp|Q165E2|GLGB_ROSDO 1,4-alpha-glucan branching enzyme GlgB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=glgB PE=3 SV=1 80 691 2.0E-41
sp|Q0B3Y4|GLGB_BURCM 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=glgB PE=3 SV=1 69 650 2.0E-41
sp|Q8DT52|GLGB_STRMU 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glgB PE=3 SV=1 65 650 3.0E-41
sp|Q8U8L4|GLGB_AGRFC 1,4-alpha-glucan branching enzyme GlgB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glgB PE=3 SV=1 80 430 3.0E-41
sp|Q9Z876|GLGB_CHLPN 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydia pneumoniae GN=glgB PE=3 SV=1 63 650 6.0E-41
sp|Q6A8Q7|GLGB_PROAC 1,4-alpha-glucan branching enzyme GlgB OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=glgB PE=3 SV=1 80 429 1.0E-40
sp|Q1MBS9|GLGB1_RHIL3 1,4-alpha-glucan branching enzyme GlgB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=glgB1 PE=3 SV=1 75 645 1.0E-40
sp|Q6MAB4|GLGB_PARUW 1,4-alpha-glucan branching enzyme GlgB OS=Protochlamydia amoebophila (strain UWE25) GN=glgB PE=3 SV=1 75 650 1.0E-40
sp|Q92M14|GLGB_RHIME 1,4-alpha-glucan branching enzyme GlgB OS=Rhizobium meliloti (strain 1021) GN=glgB PE=3 SV=1 80 430 2.0E-40
sp|Q7WII7|GLGB_BORBR 1,4-alpha-glucan branching enzyme GlgB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glgB PE=3 SV=1 55 686 2.0E-40
sp|A3CM01|GLGB_STRSV 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus sanguinis (strain SK36) GN=glgB PE=3 SV=1 69 650 2.0E-40
sp|Q13S07|GLGB_BURXL 1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia xenovorans (strain LB400) GN=glgB PE=3 SV=1 67 650 2.0E-40
sp|Q823Y5|GLGB_CHLCV 1,4-alpha-glucan branching enzyme GlgB OS=Chlamydophila caviae (strain GPIC) GN=glgB PE=3 SV=1 75 429 2.0E-40
sp|Q7W6L4|GLGB_BORPA 1,4-alpha-glucan branching enzyme GlgB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glgB PE=3 SV=1 55 686 3.0E-40
sp|Q7VYK0|GLGB_BORPE 1,4-alpha-glucan branching enzyme GlgB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glgB PE=3 SV=1 55 686 4.0E-40
sp|A8AQY3|GLGB_CITK8 1,4-alpha-glucan branching enzyme GlgB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glgB PE=3 SV=1 80 689 7.0E-40
sp|A8AYH3|GLGB_STRGC 1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glgB PE=3 SV=1 69 650 7.0E-40
sp|A6TF51|GLGB_KLEP7 1,4-alpha-glucan branching enzyme GlgB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glgB PE=3 SV=1 80 689 1.0E-39
sp|Q59833|GLGB1_STRCO 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB1 PE=3 SV=2 80 655 3.0E-39
sp|Q55088|TREZ_SULSF Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus GN=treZ PE=1 SV=2 65 356 1.0E-18
sp|Q9RX51|TREZ_DEIRA Malto-oligosyltrehalose trehalohydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=treZ PE=1 SV=1 191 353 4.0E-17
sp|P95867|TREZ_SULSO Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=treZ PE=1 SV=1 65 354 4.0E-15
sp|Q44316|TREZ_ARTSQ Malto-oligosyltrehalose trehalohydrolase OS=Arthrobacter sp. (strain Q36) GN=treZ PE=3 SV=1 136 423 1.0E-12
sp|O52520|TREZ_BREHE Malto-oligosyltrehalose trehalohydrolase OS=Brevibacterium helvolum GN=treZ PE=3 SV=1 80 353 2.0E-11
sp|Q53238|TREZ_RHIS1 Malto-oligosyltrehalose trehalohydrolase OS=Rhizobium sp. (strain M-11) GN=treZ PE=3 SV=1 134 353 3.0E-11
sp|Q9M0S5|ISOA3_ARATH Isoamylase 3, chloroplastic OS=Arabidopsis thaliana GN=ISA3 PE=2 SV=2 215 348 4.0E-11
sp|B2VJR7|GLGX_ERWT9 Glycogen debranching enzyme OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glgX PE=3 SV=1 182 353 6.0E-11
sp|A6TF50|GLGX_KLEP7 Glycogen debranching enzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glgX PE=3 SV=1 150 356 1.0E-10
sp|Q9AJN6|TREZ_ARTRM Malto-oligosyltrehalose trehalohydrolase OS=Arthrobacter ramosus GN=treZ PE=3 SV=1 164 353 2.0E-10
sp|O04196|ISOA1_ARATH Isoamylase 1, chloroplastic OS=Arabidopsis thaliana GN=ISA1 PE=1 SV=1 190 348 4.0E-10
sp|B5XTQ8|GLGX_KLEP3 Glycogen debranching enzyme OS=Klebsiella pneumoniae (strain 342) GN=glgX PE=3 SV=1 175 356 1.0E-09
sp|A8AQY2|GLGX_CITK8 Glycogen debranching enzyme OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glgX PE=3 SV=1 172 353 2.0E-09
sp|Q31VJ2|GLGX_SHIBS Glycogen debranching enzyme OS=Shigella boydii serotype 4 (strain Sb227) GN=glgX PE=3 SV=1 182 353 3.0E-09
sp|Q8KR69|GLGX_DICCH Glycogen debranching enzyme OS=Dickeya chrysanthemi GN=glgX PE=1 SV=1 173 353 3.0E-09
sp|Q8Z234|GLGX_SALTI Glycogen debranching enzyme OS=Salmonella typhi GN=glgX PE=3 SV=1 182 353 4.0E-09
sp|Q3YW94|GLGX_SHISS Glycogen debranching enzyme OS=Shigella sonnei (strain Ss046) GN=glgX PE=3 SV=1 182 353 5.0E-09
sp|B5BHI1|GLGX_SALPK Glycogen debranching enzyme OS=Salmonella paratyphi A (strain AKU_12601) GN=glgX PE=3 SV=1 182 353 7.0E-09
sp|Q5PM07|GLGX_SALPA Glycogen debranching enzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glgX PE=3 SV=1 182 353 7.0E-09
sp|P9WQ23|TREZ_MYCTU Malto-oligosyltrehalose trehalohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treZ PE=1 SV=1 77 356 8.0E-09
sp|P9WQ22|TREZ_MYCTO Malto-oligosyltrehalose trehalohydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treZ PE=3 SV=1 77 356 8.0E-09
sp|B1IP33|GLGX_ECOLC Glycogen debranching enzyme OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|A8A5P1|GLGX_ECOHS Glycogen debranching enzyme OS=Escherichia coli O9:H4 (strain HS) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B7N1M3|GLGX_ECO81 Glycogen debranching enzyme OS=Escherichia coli O81 (strain ED1a) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B7L4W3|GLGX_ECO55 Glycogen debranching enzyme OS=Escherichia coli (strain 55989 / EAEC) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B7UKY8|GLGX_ECO27 Glycogen debranching enzyme OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B6I2Z7|GLGX_ECOSE Glycogen debranching enzyme OS=Escherichia coli (strain SE11) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B7NE41|GLGX_ECOLU Glycogen debranching enzyme OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|A7ZSW4|GLGX_ECO24 Glycogen debranching enzyme OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|P15067|GLGX_ECOLI Glycogen debranching enzyme OS=Escherichia coli (strain K12) GN=glgX PE=1 SV=3 182 353 8.0E-09
sp|Q0TC28|GLGX_ECOL5 Glycogen debranching enzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B1X776|GLGX_ECODH Glycogen debranching enzyme OS=Escherichia coli (strain K12 / DH10B) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|C4ZVY1|GLGX_ECOBW Glycogen debranching enzyme OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B2U4G1|GLGX_SHIB3 Glycogen debranching enzyme OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|Q83J89|GLGX_SHIFL Glycogen debranching enzyme OS=Shigella flexneri GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|Q0SZN3|GLGX_SHIF8 Glycogen debranching enzyme OS=Shigella flexneri serotype 5b (strain 8401) GN=glgX PE=3 SV=1 182 353 8.0E-09
sp|B5YUI7|GLGX_ECO5E Glycogen debranching enzyme OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glgX PE=3 SV=1 182 353 9.0E-09
sp|Q8X6X8|GLGX_ECO57 Glycogen debranching enzyme OS=Escherichia coli O157:H7 GN=glgX PE=3 SV=1 182 353 9.0E-09
sp|B1LI92|GLGX_ECOSM Glycogen debranching enzyme OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glgX PE=3 SV=1 182 353 9.0E-09
sp|B7M2J4|GLGX_ECO8A Glycogen debranching enzyme OS=Escherichia coli O8 (strain IAI1) GN=glgX PE=3 SV=1 182 353 9.0E-09
sp|B7NMJ6|GLGX_ECO7I Glycogen debranching enzyme OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glgX PE=3 SV=1 182 353 9.0E-09
sp|Q8FCR8|GLGX_ECOL6 Glycogen debranching enzyme OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glgX PE=3 SV=1 182 353 9.0E-09
sp|Q32AV4|GLGX_SHIDS Glycogen debranching enzyme OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glgX PE=3 SV=1 182 353 9.0E-09
sp|Q6CZK1|GLGX_PECAS Glycogen debranching enzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glgX PE=3 SV=1 172 356 1.0E-08
sp|A4WFL4|GLGX_ENT38 Glycogen debranching enzyme OS=Enterobacter sp. (strain 638) GN=glgX PE=3 SV=1 190 353 1.0E-08
sp|A9MTV3|GLGX_SALPB Glycogen debranching enzyme OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glgX PE=3 SV=1 182 353 1.0E-08
sp|B7LSE2|GLGX_ESCF3 Glycogen debranching enzyme OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glgX PE=3 SV=1 121 353 2.0E-08
sp|Q8ZLG6|GLGX_SALTY Glycogen debranching enzyme OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|C0Q0L1|GLGX_SALPC Glycogen debranching enzyme OS=Salmonella paratyphi C (strain RKS4594) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B4T869|GLGX_SALHS Glycogen debranching enzyme OS=Salmonella heidelberg (strain SL476) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|Q57IT9|GLGX_SALCH Glycogen debranching enzyme OS=Salmonella choleraesuis (strain SC-B67) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B4TY88|GLGX_SALSV Glycogen debranching enzyme OS=Salmonella schwarzengrund (strain CVM19633) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B5F8Q3|GLGX_SALA4 Glycogen debranching enzyme OS=Salmonella agona (strain SL483) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B4SVN4|GLGX_SALNS Glycogen debranching enzyme OS=Salmonella newport (strain SL254) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B5R7H8|GLGX_SALG2 Glycogen debranching enzyme OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|A1AGW4|GLGX_ECOK1 Glycogen debranching enzyme OS=Escherichia coli O1:K1 / APEC GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B7MDR6|GLGX_ECO45 Glycogen debranching enzyme OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|Q1R5J5|GLGX_ECOUT Glycogen debranching enzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B5R396|GLGX_SALEP Glycogen debranching enzyme OS=Salmonella enteritidis PT4 (strain P125109) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|B5FKF6|GLGX_SALDC Glycogen debranching enzyme OS=Salmonella dublin (strain CT_02021853) GN=glgX PE=3 SV=1 182 353 2.0E-08
sp|C6DH78|GLGX_PECCP Glycogen debranching enzyme OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glgX PE=3 SV=1 190 353 8.0E-08
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 178 348 9.0E-08
sp|P9WQ25|GLGX_MYCTU Glycogen operon protein GlgX homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgX PE=1 SV=1 182 358 1.0E-07
sp|P9WQ24|GLGX_MYCTO Glycogen operon protein GlgX homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgX PE=3 SV=1 182 358 1.0E-07
sp|P0A4Y5|GLGX_MYCBO Glycogen operon protein GlgX homolog OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgX PE=3 SV=1 182 358 1.0E-07
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 215 351 2.0E-07
sp|P45178|GLGX_HAEIN Glycogen operon protein GlgX homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glgX PE=3 SV=1 172 353 3.0E-07
sp|A7MGF3|GLGX_CROS8 Glycogen debranching enzyme OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glgX PE=3 SV=1 173 356 3.0E-07
sp|C0SPA0|PULA_BACSU Pullulanase OS=Bacillus subtilis (strain 168) GN=amyX PE=1 SV=1 56 348 4.0E-07
sp|Q8L735|ISOA2_ARATH Isoamylase 2, chloroplastic OS=Arabidopsis thaliana GN=ISA2 PE=1 SV=2 218 359 5.0E-07
sp|P07191|MAL2_DROME Maltase A2 OS=Drosophila melanogaster GN=Mal-A2 PE=2 SV=2 215 350 2.0E-06
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 218 348 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0043169 cation binding Yes
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2509
MAATVDRGLSSDKFNDGTGVIQLDPWLSPFTDALKSRFSRAQHLLDNINSTEGGIDKFSKGGERFGFNVNNKNEI
VYREWAPNAKEAFLVGDFNGWDRDSHPMHKGTDGVFEITIPPKDDQPAIPHNSKVKISLVLPNGERVERIPAWIH
YVTQDLNVSPVYEGRLWNPSQSERYSFKHERPKKPESARVYEAHVGISTPEQRVATYQEFTRNMLPRIKELGYNV
IQLMAVMEHAYYASFGYQVNNFFAASSRYGTPEDLKQLIDTAHSMGILVLLDVVHSHASKNVLDGLNHFDGTDHQ
YFHGGGKGCHDQWDSRIFNYGHHEVLRFLLSNLRFWMEEYKFDGFRFDGVTSMLYTHHGMGTGFSGGYHEYFGAD
VDEEAVAYLMIANEMLHALYPNCITIAEDVSGMPALCLPLSMGGVGFDYRLAMAIPDMWIKTLKEVKDEDWDMAS
ICHTLTNRRHGEKTIAYCESHDQALVGDKTLMMHLCDAELYTNMSVLSPLTSVIDRGMALHKMIRLLTHGLGGEG
YLNFEGNEFGHPEWLDFPRQGNNNSFWYARRQLNLTDDGLLRYQFLNNFDRLMNTCEEKYGWLHAAQAYISLKHQ
GDKVIVFERAGVVFIFNFHPQQSFSDYRIGVDAAGTYRIVLNTDSKDVGGYDRIDEKTRFFTTPMEWNGRKNWTQ
VYIPCRTALVLAREDGVSQ*
Coding >OphauB2|2509
ATGGCCGCGACTGTGGATCGGGGTCTTAGTAGCGACAAGTTCAACGATGGCACTGGAGTTATTCAACTAGATCCA
TGGCTATCCCCATTTACAGACGCCCTCAAGAGTCGCTTTTCTCGAGCGCAACACCTCCTTGACAACATCAATTCA
ACAGAAGGCGGAATCGACAAGTTCTCAAAAGGCGGCGAACGGTTTGGCTTTAATGTCAACAACAAAAACGAAATC
GTGTATAGAGAGTGGGCCCCAAATGCCAAAGAAGCTTTCCTCGTTGGTGATTTCAACGGCTGGGATCGAGACTCT
CATCCCATGCATAAAGGTACTGACGGCGTCTTCGAAATCACTATCCCACCCAAAGATGACCAACCAGCCATACCT
CACAACTCAAAGGTCAAAATATCTCTCGTCCTACCCAACGGTGAACGCGTGGAACGAATTCCTGCTTGGATTCAT
TACGTCACCCAAGACCTCAACGTGTCTCCTGTGTACGAGGGGCGGTTGTGGAACCCCTCCCAGAGCGAAAGGTAT
AGTTTCAAACATGAGCGTCCCAAGAAGCCAGAAAGTGCACGAGTATACGAGGCACACGTAGGCATATCAACCCCC
GAACAGCGCGTGGCCACGTACCAGGAATTTACGCGCAATATGCTTCCTCGCATCAAAGAGTTGGGTTACAATGTG
ATTCAACTCATGGCAGTCATGGAACATGCCTACTACGCGAGCTTTGGGTATCAGGTCAACAATTTCTTTGCAGCG
AGCAGTCGCTATGGTACCCCCGAGGATCTCAAGCAACTTATCGACACGGCGCATAGCATGGGAATTCTTGTCCTC
CTCGATGTTGTCCACAGCCATGCTTCCAAGAATGTGCTGGATGGTCTCAATCATTTCGACGGCACTGACCACCAA
TATTTTCATGGCGGTGGTAAAGGCTGCCACGATCAATGGGATTCTAGAATATTCAACTATGGACATCATGAAGTT
CTGCGATTTCTCTTGAGTAACTTGCGGTTCTGGATGGAAGAATACAAATTTGATGGGTTCCGCTTCGATGGTGTT
ACCAGTATGCTTTACACTCATCATGGCATGGGCACTGGCTTCTCTGGCGGCTATCACGAATACTTTGGAGCTGAC
GTTGATGAGGAGGCCGTGGCTTATCTCATGATTGCCAATGAGATGCTGCACGCTTTATATCCAAACTGTATCACG
ATTGCTGAGGACGTGTCGGGAATGCCTGCACTCTGCTTGCCACTCTCTATGGGTGGCGTAGGGTTTGACTATCGC
TTAGCCATGGCTATTCCTGACATGTGGATCAAGACGCTGAAAGAAGTCAAAGACGAAGACTGGGATATGGCTAGT
ATTTGTCACACACTGACAAATCGGCGTCATGGCGAAAAGACTATTGCGTACTGTGAAAGCCATGATCAGGCGCTA
GTTGGTGATAAAACTCTGATGATGCACTTGTGCGATGCCGAGCTATACACCAACATGTCGGTACTGTCACCGCTC
ACATCTGTTATTGATCGTGGCATGGCTCTTCACAAAATGATTCGATTGCTCACCCACGGTCTGGGAGGGGAAGGG
TACCTCAATTTTGAAGGTAATGAGTTCGGGCACCCGGAATGGCTTGACTTTCCACGTCAAGGCAACAACAATTCA
TTTTGGTACGCACGACGCCAGCTGAATTTGACGGACGACGGCTTGCTGCGCTATCAGTTTCTGAACAACTTTGAC
CGTTTGATGAATACGTGCGAAGAAAAGTACGGCTGGCTCCACGCGGCGCAGGCCTACATTTCCCTCAAGCACCAA
GGCGATAAAGTGATTGTCTTTGAGAGGGCGGGAGTGGTTTTCATCTTCAACTTCCATCCGCAGCAGAGCTTCAGT
GACTATCGCATTGGTGTTGACGCCGCGGGAACATATCGCATCGTTCTCAATACCGACTCCAAGGACGTGGGCGGC
TACGACAGAATCGATGAGAAGACACGGTTTTTCACGACGCCCATGGAGTGGAATGGCAGAAAGAACTGGACCCAG
GTCTACATTCCATGTCGTACTGCATTGGTGCTGGCACGGGAAGACGGCGTGTCGCAATGA
Transcript >OphauB2|2509
ATGGCCGCGACTGTGGATCGGGGTCTTAGTAGCGACAAGTTCAACGATGGCACTGGAGTTATTCAACTAGATCCA
TGGCTATCCCCATTTACAGACGCCCTCAAGAGTCGCTTTTCTCGAGCGCAACACCTCCTTGACAACATCAATTCA
ACAGAAGGCGGAATCGACAAGTTCTCAAAAGGCGGCGAACGGTTTGGCTTTAATGTCAACAACAAAAACGAAATC
GTGTATAGAGAGTGGGCCCCAAATGCCAAAGAAGCTTTCCTCGTTGGTGATTTCAACGGCTGGGATCGAGACTCT
CATCCCATGCATAAAGGTACTGACGGCGTCTTCGAAATCACTATCCCACCCAAAGATGACCAACCAGCCATACCT
CACAACTCAAAGGTCAAAATATCTCTCGTCCTACCCAACGGTGAACGCGTGGAACGAATTCCTGCTTGGATTCAT
TACGTCACCCAAGACCTCAACGTGTCTCCTGTGTACGAGGGGCGGTTGTGGAACCCCTCCCAGAGCGAAAGGTAT
AGTTTCAAACATGAGCGTCCCAAGAAGCCAGAAAGTGCACGAGTATACGAGGCACACGTAGGCATATCAACCCCC
GAACAGCGCGTGGCCACGTACCAGGAATTTACGCGCAATATGCTTCCTCGCATCAAAGAGTTGGGTTACAATGTG
ATTCAACTCATGGCAGTCATGGAACATGCCTACTACGCGAGCTTTGGGTATCAGGTCAACAATTTCTTTGCAGCG
AGCAGTCGCTATGGTACCCCCGAGGATCTCAAGCAACTTATCGACACGGCGCATAGCATGGGAATTCTTGTCCTC
CTCGATGTTGTCCACAGCCATGCTTCCAAGAATGTGCTGGATGGTCTCAATCATTTCGACGGCACTGACCACCAA
TATTTTCATGGCGGTGGTAAAGGCTGCCACGATCAATGGGATTCTAGAATATTCAACTATGGACATCATGAAGTT
CTGCGATTTCTCTTGAGTAACTTGCGGTTCTGGATGGAAGAATACAAATTTGATGGGTTCCGCTTCGATGGTGTT
ACCAGTATGCTTTACACTCATCATGGCATGGGCACTGGCTTCTCTGGCGGCTATCACGAATACTTTGGAGCTGAC
GTTGATGAGGAGGCCGTGGCTTATCTCATGATTGCCAATGAGATGCTGCACGCTTTATATCCAAACTGTATCACG
ATTGCTGAGGACGTGTCGGGAATGCCTGCACTCTGCTTGCCACTCTCTATGGGTGGCGTAGGGTTTGACTATCGC
TTAGCCATGGCTATTCCTGACATGTGGATCAAGACGCTGAAAGAAGTCAAAGACGAAGACTGGGATATGGCTAGT
ATTTGTCACACACTGACAAATCGGCGTCATGGCGAAAAGACTATTGCGTACTGTGAAAGCCATGATCAGGCGCTA
GTTGGTGATAAAACTCTGATGATGCACTTGTGCGATGCCGAGCTATACACCAACATGTCGGTACTGTCACCGCTC
ACATCTGTTATTGATCGTGGCATGGCTCTTCACAAAATGATTCGATTGCTCACCCACGGTCTGGGAGGGGAAGGG
TACCTCAATTTTGAAGGTAATGAGTTCGGGCACCCGGAATGGCTTGACTTTCCACGTCAAGGCAACAACAATTCA
TTTTGGTACGCACGACGCCAGCTGAATTTGACGGACGACGGCTTGCTGCGCTATCAGTTTCTGAACAACTTTGAC
CGTTTGATGAATACGTGCGAAGAAAAGTACGGCTGGCTCCACGCGGCGCAGGCCTACATTTCCCTCAAGCACCAA
GGCGATAAAGTGATTGTCTTTGAGAGGGCGGGAGTGGTTTTCATCTTCAACTTCCATCCGCAGCAGAGCTTCAGT
GACTATCGCATTGGTGTTGACGCCGCGGGAACATATCGCATCGTTCTCAATACCGACTCCAAGGACGTGGGCGGC
TACGACAGAATCGATGAGAAGACACGGTTTTTCACGACGCCCATGGAGTGGAATGGCAGAAAGAACTGGACCCAG
GTCTACATTCCATGTCGTACTGCATTGGTGCTGGCACGGGAAGACGGCGTGTCGCAATGA
Gene >OphauB2|2509
ATGGCCGCGACTGTGGATCGGGGTCTTAGTAGCGACAAGTTCAACGATGGCACTGGTAAGCTCCAAACAAAAGCA
TCCAATACTACTAGGTCTAATTAAATGGCAACAGGAGTTATTCAACTAGATCCATGGCTATCCCCATTTACAGAC
GCCCTCAAGAGTCGCTTTTCTCGAGCGCAACACCTCCTTGACAACATCAATTCAACAGAAGGCGGAATCGACAAG
TTCTCAAAAGTAAGCAAATTCAATCTAATCCTCGACACTTTGTTACCAACGCACAGGACATGAATAGGGCGGCGA
ACGGTTTGGCTTTAATGTCAACAACAAAAACGAAATCGTGTATAGAGAGTGGGCCCCAAATGCCAAAGAAGCTTT
CCTCGTTGGTGATTTCAGTAAGTTGCTTGCAATCATGTTGGAGAGCATAGCTAACAACCTGGCTGAGACGGCTGG
GATCGAGACTCTCATCCCATGCATAAAGGTACTGACGGCGTCTTCGAAATCACTATCCCACCCAAAGATGACCAA
CCAGCCATACCTCACAACTCAAAGGTCAAAGTTGGTAGCCATACAAGCTATACTCTGGCTCCGATTCACGCTGAT
ATGCGCTTAGATATCTCTCGTCCTACCCAACGGTGAACGCGTGGAACGAATTCCTGCTTGGATTCATTACGTCAC
CCAAGACCTCAACGTGTCTCCTGTGTACGAGGGGCGGTTGTGGAACCCCTCCCAGAGCGAAAGGTATAGTTTCAA
ACATGAGCGTCCCAAGAAGCCAGAAAGTGCACGAGTATACGAGGCACACGTAGGCATATCAACCCCCGAACAGCG
CGTGGCCACGTACCAGGAATTTACGCGCAATATGCTTCCTCGCATCAAAGAGTTGGGTTACAATGTGATTCAACT
CATGGCAGTCATGGAACATGCCTACTACGCGAGCTTTGGGTATCAGGTCAACAATTTCTTTGCAGCGAGCAGTCG
CTATGGTACCCCCGAGGATCTCAAGCAACTTATCGACACGGCGCATAGCATGGGAATTCTTGTCCTCCTCGATGT
TGTCCACAGCCATGCTTCCAAGAATGTGCTGGATGGTCTCAATCATTTCGACGGCACTGACCACCAATATTTTCA
TGGCGGTGGTAAAGGCTGCCACGATCAATGGGATTCTAGAATATTCAACTATGGACATCATGAAGTTCTGCGATT
TCTCTTGAGTAACTTGCGGTTCTGGATGGAAGAATACAAATTTGATGGGTTCCGCTTCGATGGTGTTACCAGTAT
GCTTTACACTCATCATGGCATGGGCACGTAAGTTGCTCCTCGTTTGGGTGAAGTGATTTCCTTCTTCCTACCGGG
TTGCTAAAGCGATATAGTGGCTTCTCTGGCGGCTATCACGAATACTTTGGAGCTGACGTTGATGAGGAGGCCGTG
GCTTATCTCATGATTGCCAATGAGATGCTGCACGCTTTATATCCAAACTGTATCACGATTGCTGAGGACGTGTCG
GGAATGCCTGCACTCTGCTTGCCACTCTCTATGGGTGGCGTAGGGTTTGACTATCGCTTAGCCATGGCTATTCCT
GACATGTGGATCAAGACGCTGAAAGAAGTCAAAGACGAAGACTGGGATATGGCTAGTATTTGTCACACACTGACA
AATCGGCGTCATGGCGAAAAGACTATTGCGTACTGTGAAAGCCATGATCAGGCGTGAGTCTTGCTGCTCGGCTTA
CAAGCGTTGGACTAACCAGTTGGATAGGCTAGTTGGTGATAAAACTCTGATGATGCACTTGTGCGATGCCGAGCT
ATACACCAACATGTCGGTACTGTCACCGCTCACATCTGTTATTGATCGTGGCATGGCTCTTCACAAAATGATTCG
ATTGCTCACCCACGGTCTGGGAGGGGAAGGGTACCTCAATTTTGAAGGTAATGAGTTCGGGCACCCGGAATGGCT
TGACTTTCCACGTCAAGGCAACAACAATTCATTTTGGTACGCACGACGCCAGCTGAATTTGACGGACGACGGCTT
GCTGCGCTATCAGTTTCTGAACAACTTTGACCGTTTGATGAATACGTGCGAAGAAAAGTACGGCTGGCTCCACGC
GGCGCAGGCCTACATTTCCCTCAAGCACCAAGGCGATAAAGTGATTGTCTTTGAGAGGGCGGGAGTGGTTTTCAT
CTTCAACTTCCATCCGCAGCAGAGCTTCAGTGACTATCGCATTGGTGTTGACGCCGCGGGAACATATCGCATCGT
TCTCAATACCGACTCCAAGGACGTGGGCGGCTACGACAGAATCGATGAGAAGACACGGTTTTTCACGACGCCCAT
GGAGTGGAATGGCAGAAAGAACTGGACCCAGGTCTACATTCCATGTCGTACTGCATTGGTAAGAATGCCAACTCA
TTGATGAATCTGCCATGGCTGACTGATGGTGTCCAGGTGCTGGCACGGGAAGACGGCGTGTCGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail