Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2508
Gene name
LocationContig_18:122331..124040
Strand-
Gene length (bp)1709
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 1.1E-61 129 347
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 2.2E-16 14 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23704|ATPB_NEUCR ATP synthase subunit beta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-2 PE=2 SV=1 15 470 0.0E+00
sp|P22068|ATPB_SCHPO ATP synthase subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp2 PE=1 SV=1 18 469 0.0E+00
sp|P00830|ATPB_YEAST ATP synthase subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP2 PE=1 SV=2 15 455 0.0E+00
sp|P49376|ATPB_KLULA ATP synthase subunit beta, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP2 PE=3 SV=2 6 455 0.0E+00
sp|Q9PTY0|ATPB_CYPCA ATP synthase subunit beta, mitochondrial OS=Cyprinus carpio GN=atp5b PE=2 SV=1 15 468 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23704|ATPB_NEUCR ATP synthase subunit beta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-2 PE=2 SV=1 15 470 0.0E+00
sp|P22068|ATPB_SCHPO ATP synthase subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp2 PE=1 SV=1 18 469 0.0E+00
sp|P00830|ATPB_YEAST ATP synthase subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP2 PE=1 SV=2 15 455 0.0E+00
sp|P49376|ATPB_KLULA ATP synthase subunit beta, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP2 PE=3 SV=2 6 455 0.0E+00
sp|Q9PTY0|ATPB_CYPCA ATP synthase subunit beta, mitochondrial OS=Cyprinus carpio GN=atp5b PE=2 SV=1 15 468 0.0E+00
sp|P56480|ATPB_MOUSE ATP synthase subunit beta, mitochondrial OS=Mus musculus GN=Atp5b PE=1 SV=2 15 468 0.0E+00
sp|P10719|ATPB_RAT ATP synthase subunit beta, mitochondrial OS=Rattus norvegicus GN=Atp5b PE=1 SV=2 15 468 0.0E+00
sp|P06576|ATPB_HUMAN ATP synthase subunit beta, mitochondrial OS=Homo sapiens GN=ATP5B PE=1 SV=3 15 468 0.0E+00
sp|P00829|ATPB_BOVIN ATP synthase subunit beta, mitochondrial OS=Bos taurus GN=ATP5B PE=1 SV=2 15 468 0.0E+00
sp|Q5ZLC5|ATPB_CHICK ATP synthase subunit beta, mitochondrial OS=Gallus gallus GN=ATP5B PE=1 SV=1 15 468 0.0E+00
sp|Q25117|ATPB_HEMPU ATP synthase subunit beta, mitochondrial OS=Hemicentrotus pulcherrimus PE=2 SV=1 22 469 0.0E+00
sp|P46561|ATPB_CAEEL ATP synthase subunit beta, mitochondrial OS=Caenorhabditis elegans GN=atp-2 PE=1 SV=2 15 465 0.0E+00
sp|Q05825|ATPB_DROME ATP synthase subunit beta, mitochondrial OS=Drosophila melanogaster GN=ATPsynbeta PE=1 SV=3 15 468 0.0E+00
sp|Q2G5N5|ATPB_NOVAD ATP synthase subunit beta OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q162S9|ATPB_ROSDO ATP synthase subunit beta OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpD PE=3 SV=1 21 468 0.0E+00
sp|P19023|ATPBM_MAIZE ATP synthase subunit beta, mitochondrial OS=Zea mays GN=ATPB PE=2 SV=1 15 468 0.0E+00
sp|Q0C100|ATPB_HYPNA ATP synthase subunit beta OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|Q5LNP1|ATPB_RUEPO ATP synthase subunit beta OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A5V3X5|ATPB_SPHWW ATP synthase subunit beta OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|Q8UC76|ATPB_AGRFC ATP synthase subunit beta OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpD PE=3 SV=1 21 468 0.0E+00
sp|Q1GEU8|ATPB_RUEST ATP synthase subunit beta OS=Ruegeria sp. (strain TM1040) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|P17614|ATPBM_NICPL ATP synthase subunit beta, mitochondrial OS=Nicotiana plumbaginifolia GN=ATPB PE=1 SV=1 15 468 0.0E+00
sp|Q01859|ATPBM_ORYSJ ATP synthase subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=ATPB PE=1 SV=2 15 468 0.0E+00
sp|Q4FP38|ATPB_PELUB ATP synthase subunit beta OS=Pelagibacter ubique (strain HTCC1062) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q11DD5|ATPB_CHESB ATP synthase subunit beta OS=Chelativorans sp. (strain BNC1) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|Q3J431|ATPB1_RHOS4 ATP synthase subunit beta 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpD1 PE=3 SV=1 15 468 0.0E+00
sp|A3PIB9|ATPB1_RHOS1 ATP synthase subunit beta 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpD1 PE=3 SV=1 15 468 0.0E+00
sp|Q3SVJ1|ATPB_NITWN ATP synthase subunit beta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|B6JD09|ATPB_OLICO ATP synthase subunit beta OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q1GQS5|ATPB_SPHAL ATP synthase subunit beta OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|Q6NDD2|ATPB_RHOPA ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A8LJR4|ATPB2_DINSH ATP synthase subunit beta 2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpD2 PE=3 SV=1 15 468 0.0E+00
sp|A4WUM7|ATPB_RHOS5 ATP synthase subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|P05440|ATPB_RHOBL ATP synthase subunit beta OS=Rhodobacter blasticus GN=atpD PE=3 SV=1 22 455 0.0E+00
sp|A7IH31|ATPB_XANP2 ATP synthase subunit beta OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q2N8Z2|ATPB_ERYLH ATP synthase subunit beta OS=Erythrobacter litoralis (strain HTCC2594) GN=atpD PE=3 SV=1 21 465 0.0E+00
sp|A6UDM1|ATPB_SINMW ATP synthase subunit beta OS=Sinorhizobium medicae (strain WSM419) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|Q2VZN2|ATPB_MAGSA ATP synthase subunit beta OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpD PE=3 SV=1 15 453 0.0E+00
sp|Q07UZ5|ATPB_RHOP5 ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q13DP2|ATPB_RHOPS ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|P83484|ATPBN_ARATH ATP synthase subunit beta-2, mitochondrial OS=Arabidopsis thaliana GN=At5g08690 PE=1 SV=1 15 468 0.0E+00
sp|P83483|ATPBM_ARATH ATP synthase subunit beta-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08670 PE=1 SV=1 15 468 0.0E+00
sp|P05038|ATPB_RHORU ATP synthase subunit beta OS=Rhodospirillum rubrum GN=atpD PE=1 SV=3 15 458 0.0E+00
sp|Q2RV18|ATPB_RHORT ATP synthase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|Q2J3I4|ATPB_RHOP2 ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A7HT52|ATPB_PARL1 ATP synthase subunit beta OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpD PE=3 SV=1 19 468 0.0E+00
sp|Q9C5A9|ATPBO_ARATH ATP synthase subunit beta-3, mitochondrial OS=Arabidopsis thaliana GN=At5g08680 PE=2 SV=1 15 468 0.0E+00
sp|Q92LK8|ATPB_RHIME ATP synthase subunit beta OS=Rhizobium meliloti (strain 1021) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|P38482|ATPBM_CHLRE ATP synthase subunit beta, mitochondrial OS=Chlamydomonas reinhardtii GN=ATP2 PE=1 SV=1 15 465 0.0E+00
sp|Q21CY7|ATPB_RHOPB ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q98EV8|ATPB_RHILO ATP synthase subunit beta OS=Rhizobium loti (strain MAFF303099) GN=atpD PE=3 SV=1 22 468 0.0E+00
sp|Q8FYR5|ATPB_BRUSU ATP synthase subunit beta OS=Brucella suis biovar 1 (strain 1330) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|A9WWS2|ATPB_BRUSI ATP synthase subunit beta OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|A5VSE1|ATPB_BRUO2 ATP synthase subunit beta OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|Q8YJ35|ATPB_BRUME ATP synthase subunit beta OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|A9M837|ATPB_BRUC2 ATP synthase subunit beta OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|C3M9S1|ATPB_RHISN ATP synthase subunit beta OS=Rhizobium sp. (strain NGR234) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|P29685|ATPBM_HEVBR ATP synthase subunit beta, mitochondrial OS=Hevea brasiliensis GN=ATPB PE=2 SV=1 15 468 0.0E+00
sp|A5E950|ATPB1_BRASB ATP synthase subunit beta 1 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpD1 PE=3 SV=1 15 468 0.0E+00
sp|Q57B88|ATPB_BRUAB ATP synthase subunit beta OS=Brucella abortus biovar 1 (strain 9-941) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|Q2YLE6|ATPB_BRUA2 ATP synthase subunit beta OS=Brucella abortus (strain 2308) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|A4YKE0|ATPB_BRASO ATP synthase subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A1B8P0|ATPB_PARDP ATP synthase subunit beta OS=Paracoccus denitrificans (strain Pd 1222) GN=atpD PE=1 SV=1 15 468 0.0E+00
sp|Q89X74|ATPB_BRADU ATP synthase subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A9H9A8|ATPB_GLUDA ATP synthase subunit beta OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q1QQS8|ATPB_NITHX ATP synthase subunit beta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|P72247|ATPB_RHOCA ATP synthase subunit beta OS=Rhodobacter capsulatus GN=atpD PE=1 SV=3 15 453 0.0E+00
sp|A8HS10|ATPB_AZOC5 ATP synthase subunit beta OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q1RKD7|ATPB_RICBR ATP synthase subunit beta OS=Rickettsia bellii (strain RML369-C) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A6WXX1|ATPB_OCHA4 ATP synthase subunit beta OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|Q5FRC5|ATPB1_GLUOX ATP synthase subunit beta 1 OS=Gluconobacter oxydans (strain 621H) GN=atpD1 PE=3 SV=1 15 468 0.0E+00
sp|A8GY40|ATPB_RICB8 ATP synthase subunit beta OS=Rickettsia bellii (strain OSU 85-389) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q4UK18|ATPB_RICFE ATP synthase subunit beta OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=atpD PE=3 SV=2 15 466 0.0E+00
sp|Q28TJ6|ATPB_JANSC ATP synthase subunit beta OS=Jannaschia sp. (strain CCS1) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q5NQY9|ATPB_ZYMMO ATP synthase subunit beta OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=atpD PE=3 SV=1 21 458 0.0E+00
sp|A8F2U0|ATPB_RICM5 ATP synthase subunit beta OS=Rickettsia massiliae (strain Mtu5) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|Q68VU8|ATPB_RICTY ATP synthase subunit beta OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=atpD PE=3 SV=1 15 466 0.0E+00
sp|A8GPZ4|ATPB_RICAH ATP synthase subunit beta OS=Rickettsia akari (strain Hartford) GN=atpD PE=3 SV=1 15 466 0.0E+00
sp|A9IYW6|ATPB_BART1 ATP synthase subunit beta OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|O50290|ATPB_RICPR ATP synthase subunit beta OS=Rickettsia prowazekii (strain Madrid E) GN=atpD PE=3 SV=2 15 466 0.0E+00
sp|B3PQ68|ATPB_RHIE6 ATP synthase subunit beta OS=Rhizobium etli (strain CIAT 652) GN=atpD PE=3 SV=1 21 467 0.0E+00
sp|A8F004|ATPB_RICCK ATP synthase subunit beta OS=Rickettsia canadensis (strain McKiel) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A1UR49|ATPB_BARBK ATP synthase subunit beta OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A5FZ54|ATPB_ACICJ ATP synthase subunit beta OS=Acidiphilium cryptum (strain JF-5) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q2K3H0|ATPB_RHIEC ATP synthase subunit beta OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=atpD PE=3 SV=1 21 467 0.0E+00
sp|Q1MAZ2|ATPB_RHIL3 ATP synthase subunit beta OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpD PE=3 SV=1 21 467 0.0E+00
sp|B5ZSN7|ATPB_RHILW ATP synthase subunit beta OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpD PE=3 SV=1 21 467 0.0E+00
sp|A0LDA0|ATPB_MAGMM ATP synthase subunit beta OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=atpD PE=3 SV=1 21 467 0.0E+00
sp|B9LZ84|ATPB_GEODF ATP synthase subunit beta OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q6G1W9|ATPB_BARHE ATP synthase subunit beta OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=atpD PE=3 SV=1 15 469 0.0E+00
sp|Q0BQE8|ATPB_GRABC ATP synthase subunit beta OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|C4K227|ATPB_RICPU ATP synthase subunit beta OS=Rickettsia peacockii (strain Rustic) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q6FYM3|ATPB_BARQU ATP synthase subunit beta OS=Bartonella quintana (strain Toulouse) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q92G88|ATPB_RICCN ATP synthase subunit beta OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|A8GTS6|ATPB_RICRS ATP synthase subunit beta OS=Rickettsia rickettsii (strain Sheila Smith) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B0BVB6|ATPB_RICRO ATP synthase subunit beta OS=Rickettsia rickettsii (strain Iowa) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|Q39Q56|ATPB_GEOMG ATP synthase subunit beta OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|B0T335|ATPB_CAUSK ATP synthase subunit beta OS=Caulobacter sp. (strain K31) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q74GY0|ATPB_GEOSL ATP synthase subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|C3PLT1|ATPB_RICAE ATP synthase subunit beta OS=Rickettsia africae (strain ESF-5) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A5G9D8|ATPB_GEOUR ATP synthase subunit beta OS=Geobacter uraniireducens (strain Rf4) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P37399|ATPBM_DAUCA ATP synthase subunit beta, mitochondrial OS=Daucus carota GN=ATPB PE=3 SV=1 15 468 0.0E+00
sp|B3EA01|ATPB_GEOLS ATP synthase subunit beta OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|C6E9F1|ATPB_GEOSM ATP synthase subunit beta OS=Geobacter sp. (strain M21) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B5EFI7|ATPB_GEOBB ATP synthase subunit beta OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q0AKW0|ATPB_MARMM ATP synthase subunit beta OS=Maricaulis maris (strain MCS10) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|A1AP52|ATPB2_PELPD ATP synthase subunit beta 2 OS=Pelobacter propionicus (strain DSM 2379) GN=atpD2 PE=3 SV=1 15 467 0.0E+00
sp|Q55CS9|ATPB_DICDI ATP synthase subunit beta, mitochondrial OS=Dictyostelium discoideum GN=atp5b PE=1 SV=1 37 466 0.0E+00
sp|A1ALL7|ATPB1_PELPD ATP synthase subunit beta 1 OS=Pelobacter propionicus (strain DSM 2379) GN=atpD1 PE=3 SV=1 15 467 0.0E+00
sp|Q9A2V9|ATPB_CAUCR ATP synthase subunit beta OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|P42469|ATPB_STIAU ATP synthase subunit beta OS=Stigmatella aurantiaca GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|B3CN17|ATPB_WOLPP ATP synthase subunit beta OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpD PE=3 SV=1 15 469 0.0E+00
sp|B8DRD2|ATPB_DESVM ATP synthase subunit beta OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q2RFX9|ATPB_MOOTA ATP synthase subunit beta OS=Moorella thermoacetica (strain ATCC 39073) GN=atpD PE=1 SV=1 15 466 0.0E+00
sp|A8MJV9|ATPB_ALKOO ATP synthase subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=atpD PE=3 SV=1 15 463 0.0E+00
sp|Q73IG3|ATPB_WOLPM ATP synthase subunit beta OS=Wolbachia pipientis wMel GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|C0R5I6|ATPB_WOLWR ATP synthase subunit beta OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q1CX36|ATPB_MYXXD ATP synthase subunit beta OS=Myxococcus xanthus (strain DK 1622) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|A6TK65|ATPB_ALKMQ ATP synthase subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q2GGP9|ATPB_EHRCR ATP synthase subunit beta OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q3A605|ATPB1_PELCD ATP synthase subunit beta 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|Q39ZU1|ATPB3_PELCD ATP synthase subunit beta 3 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpD3 PE=3 SV=1 15 465 0.0E+00
sp|P50002|ATPB_ACEWD ATP synthase subunit beta, sodium ion specific OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655) GN=atpD PE=1 SV=3 15 465 0.0E+00
sp|Q3YS09|ATPB_EHRCJ ATP synthase subunit beta OS=Ehrlichia canis (strain Jake) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|B9MS68|ATPB_CALBD ATP synthase subunit beta OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A9F3R4|ATPB_SORC5 ATP synthase subunit beta OS=Sorangium cellulosum (strain So ce56) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A7HIX7|ATPB_ANADF ATP synthase subunit beta OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|A1VFJ5|ATPB_DESVV ATP synthase subunit beta OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q72E04|ATPB_DESVH ATP synthase subunit beta OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A4XKX0|ATPB_CALS8 ATP synthase subunit beta OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A0Q2Z4|ATPB_CLONN ATP synthase subunit beta OS=Clostridium novyi (strain NT) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q3A946|ATPB_CARHZ ATP synthase subunit beta OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|P42465|ATPB_CHLP8 ATP synthase subunit beta OS=Chlorobaculum parvum (strain NCIB 8327) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q5HX59|ATPB_CAMJR ATP synthase subunit beta OS=Campylobacter jejuni (strain RM1221) GN=atpD PE=3 SV=1 25 465 0.0E+00
sp|A1VXJ0|ATPB_CAMJJ ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=atpD PE=3 SV=1 25 465 0.0E+00
sp|Q0PC30|ATPB_CAMJE ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=atpD PE=3 SV=1 25 465 0.0E+00
sp|A8FJR2|ATPB_CAMJ8 ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=atpD PE=3 SV=1 25 465 0.0E+00
sp|P35110|ATPB_CHLLI ATP synthase subunit beta OS=Chlorobium limicola GN=atpD PE=3 SV=1 15 461 0.0E+00
sp|B4SAN6|ATPB_PELPB ATP synthase subunit beta OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q5GRU7|ATPB_WOLTR ATP synthase subunit beta OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpD PE=3 SV=2 15 468 0.0E+00
sp|A1BCJ2|ATPB_CHLPD ATP synthase subunit beta OS=Chlorobium phaeobacteroides (strain DSM 266) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q3B6W8|ATPB1_CHLL7 ATP synthase subunit beta 1 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpD1 PE=3 SV=2 15 465 0.0E+00
sp|Q1MRB8|ATPB_LAWIP ATP synthase subunit beta OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A8ZUA1|ATPB_DESOH ATP synthase subunit beta OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=atpD PE=3 SV=1 15 462 0.0E+00
sp|A7H1I1|ATPB_CAMJD ATP synthase subunit beta OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=atpD PE=3 SV=1 25 465 0.0E+00
sp|A3DIM9|ATPB_CLOTH ATP synthase subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B3CRK6|ATPB_ORITI ATP synthase subunit beta OS=Orientia tsutsugamushi (strain Ikeda) GN=atpD PE=3 SV=1 17 465 0.0E+00
sp|Q8RGE2|ATPB_FUSNN ATP synthase subunit beta OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpD PE=3 SV=1 21 465 0.0E+00
sp|Q67TB7|ATPB_SYMTH ATP synthase subunit beta OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpD PE=3 SV=1 15 469 0.0E+00
sp|Q5FGY3|ATPB_EHRRG ATP synthase subunit beta OS=Ehrlichia ruminantium (strain Gardel) GN=atpD PE=3 SV=2 15 468 0.0E+00
sp|Q8KAC9|ATPB2_CHLTE ATP synthase subunit beta 2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=atpD2 PE=3 SV=1 15 465 0.0E+00
sp|Q5HB71|ATPB_EHRRW ATP synthase subunit beta OS=Ehrlichia ruminantium (strain Welgevonden) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A5N3H7|ATPB_CLOK5 ATP synthase subunit beta OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=atpD PE=3 SV=1 15 455 0.0E+00
sp|A5CYE2|ATPB_PELTS ATP synthase subunit beta OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpD PE=3 SV=1 15 466 0.0E+00
sp|B8J439|ATPB_DESDA ATP synthase subunit beta OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A5CDA5|ATPB_ORITB ATP synthase subunit beta OS=Orientia tsutsugamushi (strain Boryong) GN=atpD PE=3 SV=1 17 465 0.0E+00
sp|Q8RC15|ATPB_CALS4 ATP synthase subunit beta OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q9Z687|ATPB_CLOAB ATP synthase subunit beta OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=atpD PE=3 SV=1 15 466 0.0E+00
sp|Q313W0|ATPB_DESAG ATP synthase subunit beta OS=Desulfovibrio alaskensis (strain G20) GN=atpD PE=3 SV=1 15 461 0.0E+00
sp|B1KSS8|ATPB_CLOBM ATP synthase subunit beta OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|B2TK00|ATPB_CLOBB ATP synthase subunit beta OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A7G9Q9|ATPB_CLOBL ATP synthase subunit beta OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|B1IE34|ATPB_CLOBK ATP synthase subunit beta OS=Clostridium botulinum (strain Okra / Type B1) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|B2UZK0|ATPB_CLOBA ATP synthase subunit beta OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A4SC45|ATPB_CHLPM ATP synthase subunit beta OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B9KES3|ATPB_CAMLR ATP synthase subunit beta OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=atpD PE=3 SV=1 25 465 0.0E+00
sp|A9KK92|ATPB_CLOPH ATP synthase subunit beta OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=atpD PE=3 SV=1 13 472 0.0E+00
sp|Q24MP1|ATPB_DESHY ATP synthase subunit beta OS=Desulfitobacterium hafniense (strain Y51) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|A5HY52|ATPB_CLOBH ATP synthase subunit beta OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|C3KYJ3|ATPB_CLOB6 ATP synthase subunit beta OS=Clostridium botulinum (strain 657 / Type Ba4) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|A7FQH9|ATPB_CLOB1 ATP synthase subunit beta OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|C1FQP5|ATPB_CLOBJ ATP synthase subunit beta OS=Clostridium botulinum (strain Kyoto / Type A2) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|Q180W5|ATPB_PEPD6 ATP synthase subunit beta OS=Peptoclostridium difficile (strain 630) GN=atpD PE=3 SV=1 9 463 0.0E+00
sp|B0THN2|ATPB_HELMI ATP synthase subunit beta OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q3AP13|ATPB_CHLCH ATP synthase subunit beta OS=Chlorobium chlorochromatii (strain CaD3) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B8FZ34|ATPB_DESHD ATP synthase subunit beta OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B3EJK9|ATPB_CHLPB ATP synthase subunit beta OS=Chlorobium phaeobacteroides (strain BS1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q2LR05|ATPB_SYNAS ATP synthase subunit beta OS=Syntrophus aciditrophicus (strain SB) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q2GD08|ATPB_NEOSM ATP synthase subunit beta OS=Neorickettsia sennetsu (strain Miyayama) GN=atpD PE=3 SV=1 15 461 0.0E+00
sp|A7H017|ATPB_CAMC5 ATP synthase subunit beta OS=Campylobacter curvus (strain 525.92) GN=atpD PE=3 SV=1 29 467 0.0E+00
sp|B3EDQ7|ATPB_CHLL2 ATP synthase subunit beta OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A0RR26|ATPB_CAMFF ATP synthase subunit beta OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=atpD PE=3 SV=1 22 467 0.0E+00
sp|A0LLF8|ATPB_SYNFM ATP synthase subunit beta OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q2IHQ2|ATPB_ANADE ATP synthase subunit beta OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|A7ZC37|ATPB_CAMC1 ATP synthase subunit beta OS=Campylobacter concisus (strain 13826) GN=atpD PE=3 SV=1 29 467 0.0E+00
sp|B2IUL2|ATPB_NOSP7 ATP synthase subunit beta OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B3QUP6|ATPB_CHLT3 ATP synthase subunit beta OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A6LQH6|ATPB_CLOB8 ATP synthase subunit beta OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q6AQ10|ATPB_DESPS ATP synthase subunit beta OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=atpD PE=3 SV=1 15 461 0.0E+00
sp|A4J999|ATPB_DESRM ATP synthase subunit beta OS=Desulfotomaculum reducens (strain MI-1) GN=atpD PE=3 SV=1 16 467 0.0E+00
sp|Q19V65|ATPB_CHLAT ATP synthase subunit beta, chloroplastic OS=Chlorokybus atmophyticus GN=atpB PE=3 SV=2 13 465 0.0E+00
sp|A7I177|ATPB_CAMHC ATP synthase subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=atpD PE=3 SV=1 22 467 0.0E+00
sp|A6QB59|ATPB_SULNB ATP synthase subunit beta OS=Sulfurovum sp. (strain NBC37-1) GN=atpD PE=3 SV=1 19 468 0.0E+00
sp|Q03235|ATPB_PECFR ATP synthase subunit beta OS=Pectinatus frisingensis GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|B8I579|ATPB_CLOCE ATP synthase subunit beta OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=atpD PE=3 SV=1 13 465 0.0E+00
sp|C1F3N6|ATPB_ACIC5 ATP synthase subunit beta OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q3MAS0|ATPB_ANAVT ATP synthase subunit beta OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q0SQZ5|ATPB_CLOPS ATP synthase subunit beta OS=Clostridium perfringens (strain SM101 / Type A) GN=atpD PE=3 SV=1 15 461 0.0E+00
sp|P29707|ATPB_PROMO ATP synthase subunit beta, sodium ion specific OS=Propionigenium modestum GN=atpD PE=1 SV=2 21 466 0.0E+00
sp|B9L7Y7|ATPB_NAUPA ATP synthase subunit beta OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=atpD PE=3 SV=1 28 468 0.0E+00
sp|C0Z776|ATPB_BREBN ATP synthase subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P06540|ATPB_NOSS1 ATP synthase subunit beta OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|Q85FT2|ATPB_CYAME ATP synthase subunit beta, chloroplastic OS=Cyanidioschyzon merolae GN=atpB PE=3 SV=1 15 465 0.0E+00
sp|Q5PAN2|ATPB_ANAMM ATP synthase subunit beta OS=Anaplasma marginale (strain St. Maries) GN=atpD PE=3 SV=1 9 465 0.0E+00
sp|Q8XID4|ATPB_CLOPE ATP synthase subunit beta OS=Clostridium perfringens (strain 13 / Type A) GN=atpD PE=3 SV=1 15 461 0.0E+00
sp|Q0TNC4|ATPB_CLOP1 ATP synthase subunit beta OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpD PE=3 SV=1 15 461 0.0E+00
sp|B8FGT4|ATPB_DESAA ATP synthase subunit beta OS=Desulfatibacillum alkenivorans (strain AK-01) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A6Q4C0|ATPB_NITSB ATP synthase subunit beta OS=Nitratiruptor sp. (strain SB155-2) GN=atpD PE=3 SV=1 29 468 0.0E+00
sp|Q2GKK8|ATPB_ANAPZ ATP synthase subunit beta OS=Anaplasma phagocytophilum (strain HZ) GN=atpD PE=3 SV=1 9 465 0.0E+00
sp|Q95DR6|ATPB_AGAAF ATP synthase subunit beta, chloroplastic OS=Agapanthus africanus GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|Q8MBQ4|ATPB_IPOCC ATP synthase subunit beta, chloroplastic OS=Ipomoea coccinea GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|A1WZT1|ATPB_HALHL ATP synthase subunit beta OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A5FLS1|ATPB_FLAJ1 ATP synthase subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=atpD PE=3 SV=1 21 468 0.0E+00
sp|Q6MGM7|ATPB_BDEBA ATP synthase subunit beta OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q6FFK0|ATPB_ACIAD ATP synthase subunit beta OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B9IRT7|ATPB_BACCQ ATP synthase subunit beta OS=Bacillus cereus (strain Q1) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|B7HY64|ATPB_BACC7 ATP synthase subunit beta OS=Bacillus cereus (strain AH187) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q72XE8|ATPB_BACC1 ATP synthase subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q60CR4|ATPB_METCA ATP synthase subunit beta OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=atpD PE=3 SV=1 16 467 0.0E+00
sp|A7GV56|ATPB_BACCN ATP synthase subunit beta OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|B4F0E7|ATPB_PROMH ATP synthase subunit beta OS=Proteus mirabilis (strain HI4320) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|Q7VJ21|ATPB_HELHP ATP synthase subunit beta OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=atpD PE=3 SV=1 24 465 0.0E+00
sp|Q08807|ATPB_GALSU ATP synthase subunit beta, chloroplastic OS=Galdieria sulphuraria GN=atpB PE=3 SV=1 15 465 0.0E+00
sp|Q0A4M8|ATPB_ALKEH ATP synthase subunit beta OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A6GVV9|ATPB_FLAPJ ATP synthase subunit beta OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=atpD PE=3 SV=1 21 468 0.0E+00
sp|B7JGN0|ATPB_BACC0 ATP synthase subunit beta OS=Bacillus cereus (strain AH820) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|A1AXU2|ATPB_RUTMC ATP synthase subunit beta OS=Ruthia magnifica subsp. Calyptogena magnifica GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q814W2|ATPB_BACCR ATP synthase subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|B7HFK1|ATPB_BACC4 ATP synthase subunit beta OS=Bacillus cereus (strain B4264) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|A9VSA3|ATPB_BACWK ATP synthase subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q1KVT0|ATPB_ACUOB ATP synthase subunit beta, chloroplastic OS=Acutodesmus obliquus GN=atpB PE=3 SV=1 15 461 0.0E+00
sp|A1JTC6|ATPB_YERE8 ATP synthase subunit beta OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q06SG7|ATPB_STIHE ATP synthase subunit beta, chloroplastic OS=Stigeoclonium helveticum GN=atpB PE=3 SV=1 15 455 0.0E+00
sp|P06541|ATPB_CHLRE ATP synthase subunit beta, chloroplastic OS=Chlamydomonas reinhardtii GN=atpB PE=1 SV=3 15 465 0.0E+00
sp|B0VBP3|ATPB_ACIBY ATP synthase subunit beta OS=Acinetobacter baumannii (strain AYE) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A3M144|ATPB_ACIBT ATP synthase subunit beta OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|B0VNK4|ATPB_ACIBS ATP synthase subunit beta OS=Acinetobacter baumannii (strain SDF) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B2I102|ATPB_ACIBC ATP synthase subunit beta OS=Acinetobacter baumannii (strain ACICU) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7I1W4|ATPB_ACIB5 ATP synthase subunit beta OS=Acinetobacter baumannii (strain AB0057) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7H294|ATPB_ACIB3 ATP synthase subunit beta OS=Acinetobacter baumannii (strain AB307-0294) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A8EV70|ATPB_ARCB4 ATP synthase subunit beta OS=Arcobacter butzleri (strain RM4018) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q7V049|ATPB_PROMP ATP synthase subunit beta OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|B1JRN2|ATPB_YERPY ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q663Q8|ATPB_YERPS ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A4TSJ3|ATPB_YERPP ATP synthase subunit beta OS=Yersinia pestis (strain Pestoides F) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q1CCH5|ATPB_YERPN ATP synthase subunit beta OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A9R5T9|ATPB_YERPG ATP synthase subunit beta OS=Yersinia pestis bv. Antiqua (strain Angola) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q7CFM8|ATPB_YERPE ATP synthase subunit beta OS=Yersinia pestis GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B2K847|ATPB_YERPB ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q1C095|ATPB_YERPA ATP synthase subunit beta OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A7FPE0|ATPB_YERP3 ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q6HAY0|ATPB_BACHK ATP synthase subunit beta OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q630U3|ATPB_BACCZ ATP synthase subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|C1F0M8|ATPB_BACC3 ATP synthase subunit beta OS=Bacillus cereus (strain 03BB102) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q81JZ5|ATPB_BACAN ATP synthase subunit beta OS=Bacillus anthracis GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|A0RL95|ATPB_BACAH ATP synthase subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|C3LFH9|ATPB_BACAC ATP synthase subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|C3P1F4|ATPB_BACAA ATP synthase subunit beta OS=Bacillus anthracis (strain A0248) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|C4LDW0|ATPB_TOLAT ATP synthase subunit beta OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q0QEP2|ATPB_MESAU ATP synthase subunit beta, mitochondrial (Fragment) OS=Mesocricetus auratus GN=ATP5B PE=1 SV=1 92 451 0.0E+00
sp|Q4ZL24|ATPB_PSEU2 ATP synthase subunit beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q87TT4|ATPB_PSESM ATP synthase subunit beta OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B1I6J7|ATPB_DESAP ATP synthase subunit beta OS=Desulforudis audaxviator (strain MP104C) GN=atpD PE=3 SV=1 15 466 0.0E+00
sp|Q4FQ37|ATPB_PSYA2 ATP synthase subunit beta OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q2JX57|ATPB_SYNJA ATP synthase subunit beta OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|Q6MAK7|ATPB_PARUW ATP synthase subunit beta OS=Protochlamydia amoebophila (strain UWE25) GN=atpD PE=3 SV=2 12 465 0.0E+00
sp|Q30QQ1|ATPB_SULDN ATP synthase subunit beta OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7IQV8|ATPB_BACC2 ATP synthase subunit beta OS=Bacillus cereus (strain G9842) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q0AUD3|ATPB_SYNWW ATP synthase subunit beta OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q6CYJ5|ATPB_PECAS ATP synthase subunit beta OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q0P3P2|ATPB_OSTTA ATP synthase subunit beta, chloroplastic OS=Ostreococcus tauri GN=atpB PE=3 SV=1 17 465 0.0E+00
sp|A0Q8D9|ATPB_FRATN ATP synthase subunit beta OS=Francisella tularensis subsp. novicida (strain U112) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|C5BF40|ATPB_EDWI9 ATP synthase subunit beta OS=Edwardsiella ictaluri (strain 93-146) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A8G7M8|ATPB_SERP5 ATP synthase subunit beta OS=Serratia proteamaculans (strain 568) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A2BYG3|ATPB_PROM5 ATP synthase subunit beta OS=Prochlorococcus marinus (strain MIT 9515) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|Q9JXQ2|ATPB_NEIMB ATP synthase subunit beta OS=Neisseria meningitidis serogroup B (strain MC58) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P22478|ATPB_BACPE ATP synthase subunit beta OS=Bacillus pseudofirmus (strain OF4) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|A1KW11|ATPB_NEIMF ATP synthase subunit beta OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A9M123|ATPB_NEIM0 ATP synthase subunit beta OS=Neisseria meningitidis serogroup C (strain 053442) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q2NQ86|ATPB_SODGM ATP synthase subunit beta OS=Sodalis glossinidius (strain morsitans) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q9JW70|ATPB_NEIMA ATP synthase subunit beta OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q9HT20|ATPB_PSEAE ATP synthase subunit beta OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q02DF4|ATPB_PSEAB ATP synthase subunit beta OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7V791|ATPB_PSEA8 ATP synthase subunit beta OS=Pseudomonas aeruginosa (strain LESB58) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A6VF32|ATPB_PSEA7 ATP synthase subunit beta OS=Pseudomonas aeruginosa (strain PA7) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|C3K1E6|ATPB_PSEFS ATP synthase subunit beta OS=Pseudomonas fluorescens (strain SBW25) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q48BG5|ATPB_PSE14 ATP synthase subunit beta OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|C1D5G2|ATPB_LARHH ATP synthase subunit beta OS=Laribacter hongkongensis (strain HLHK9) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q1Q899|ATPB_PSYCK ATP synthase subunit beta OS=Psychrobacter cryohalolentis (strain K5) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q06FV3|ATPB_PELHO ATP synthase subunit beta, chloroplastic OS=Pelargonium hortorum GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|Q9MU26|ATPB_NYMOD ATP synthase subunit beta, chloroplastic OS=Nymphaea odorata GN=atpB PE=3 SV=1 13 471 0.0E+00
sp|A4IW24|ATPB_FRATW ATP synthase subunit beta OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q5NIK3|ATPB_FRATT ATP synthase subunit beta OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q14K06|ATPB_FRAT1 ATP synthase subunit beta OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B0TWS7|ATPB_FRAP2 ATP synthase subunit beta OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q15MU4|ATPB2_PSEA6 ATP synthase subunit beta 2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=atpD2 PE=3 SV=1 15 465 0.0E+00
sp|B7K2R8|ATPB_CYAP8 ATP synthase subunit beta OS=Cyanothece sp. (strain PCC 8801) GN=atpD PE=3 SV=1 16 455 0.0E+00
sp|A8Y9H7|ATPB_LOLPR ATP synthase subunit beta, chloroplastic OS=Lolium perenne GN=atpB PE=3 SV=1 15 461 0.0E+00
sp|Q318V4|ATPB_PROM9 ATP synthase subunit beta OS=Prochlorococcus marinus (strain MIT 9312) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|Q223D6|ATPB1_RHOFT ATP synthase subunit beta 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|P00827|ATPB_MAIZE ATP synthase subunit beta, chloroplastic OS=Zea mays GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|A3PES6|ATPB_PROM0 ATP synthase subunit beta OS=Prochlorococcus marinus (strain MIT 9301) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|Q0BK84|ATPB_FRATO ATP synthase subunit beta OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q2A1I2|ATPB_FRATH ATP synthase subunit beta OS=Francisella tularensis subsp. holarctica (strain LVS) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A7NEH4|ATPB_FRATF ATP synthase subunit beta OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q06RC2|ATPB_JASNU ATP synthase subunit beta, chloroplastic OS=Jasminum nudiflorum GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|P13357|ATPB_CELLY ATP synthase subunit beta OS=Cellulophaga lytica GN=atpD PE=3 SV=1 22 468 0.0E+00
sp|A2BT12|ATPB_PROMS ATP synthase subunit beta OS=Prochlorococcus marinus (strain AS9601) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|Q2PMV0|ATPB_SOYBN ATP synthase subunit beta, chloroplastic OS=Glycine max GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q09X10|ATPB_MORIN ATP synthase subunit beta, chloroplastic OS=Morus indica GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|B5YI24|ATPB_THEYD ATP synthase subunit beta OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=atpD PE=3 SV=1 21 465 0.0E+00
sp|B4RJG0|ATPB_NEIG2 ATP synthase subunit beta OS=Neisseria gonorrhoeae (strain NCCP11945) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q5F4Z0|ATPB_NEIG1 ATP synthase subunit beta OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P12085|ATPB_ORYSJ ATP synthase subunit beta, chloroplastic OS=Oryza sativa subsp. japonica GN=atpB PE=1 SV=2 13 461 0.0E+00
sp|P0C2Z8|ATPB_ORYSI ATP synthase subunit beta, chloroplastic OS=Oryza sativa subsp. indica GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|P0C2Z7|ATPB_ORYSA ATP synthase subunit beta, chloroplastic OS=Oryza sativa GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|Q6ENG7|ATPB_ORYNI ATP synthase subunit beta, chloroplastic OS=Oryza nivara GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|A3QJR0|ATPB_SHELP ATP synthase subunit beta OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q21DK8|ATPB_SACD2 ATP synthase subunit beta OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=atpD PE=3 SV=1 15 458 0.0E+00
sp|B1NWF7|ATPB_MANES ATP synthase subunit beta, chloroplastic OS=Manihot esculenta GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A8G6T8|ATPB_PROM2 ATP synthase subunit beta OS=Prochlorococcus marinus (strain MIT 9215) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|Q14FF0|ATPB_POPAL ATP synthase subunit beta, chloroplastic OS=Populus alba GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A2SC70|ATPB_METPP ATP synthase subunit beta OS=Methylibium petroleiphilum (strain PM1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q6ENV6|ATPB_SACOF ATP synthase subunit beta, chloroplastic OS=Saccharum officinarum GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|Q6L392|ATPB_SACHY ATP synthase subunit beta, chloroplastic OS=Saccharum hybrid GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|B4SJR9|ATPB_STRM5 ATP synthase subunit beta OS=Stenotrophomonas maltophilia (strain R551-3) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q10Z38|ATPB_TRIEI ATP synthase subunit beta OS=Trichodesmium erythraeum (strain IMS101) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q05373|ATPB_SYNP1 ATP synthase subunit beta OS=Synechococcus sp. (strain PCC 6716) GN=atpD PE=1 SV=1 15 455 0.0E+00
sp|A8HAG3|ATPB_SHEPA ATP synthase subunit beta OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|B8GRB8|ATPB_THISH ATP synthase subunit beta OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q6QBP2|ATPB_CASSA ATP synthase subunit beta, chloroplastic OS=Castanea sativa GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|B2SEY1|ATPB_FRATM ATP synthase subunit beta OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A4GYR7|ATPB_POPTR ATP synthase subunit beta, chloroplastic OS=Populus trichocarpa GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A0L2S8|ATPB_SHESA ATP synthase subunit beta OS=Shewanella sp. (strain ANA-3) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q1IIG8|ATPB_KORVE ATP synthase subunit beta OS=Koribacter versatilis (strain Ellin345) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q5WSG8|ATPB_LEGPL ATP synthase subunit beta OS=Legionella pneumophila (strain Lens) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q5ZRA1|ATPB_LEGPH ATP synthase subunit beta OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A5III3|ATPB_LEGPC ATP synthase subunit beta OS=Legionella pneumophila (strain Corby) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q5X0P3|ATPB_LEGPA ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P26527|ATPB_SYNY3 ATP synthase subunit beta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|Q7NA94|ATPB_PHOLL ATP synthase subunit beta OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q2JIV9|ATPB_SYNJB ATP synthase subunit beta OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpD PE=3 SV=1 16 465 0.0E+00
sp|B1A942|ATPB_CARPA ATP synthase subunit beta, chloroplastic OS=Carica papaya GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|Q49KZ1|ATPB_EUCGG ATP synthase subunit beta, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q3C1J5|ATPB_NICSY ATP synthase subunit beta, chloroplastic OS=Nicotiana sylvestris GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A1E9T1|ATPB_SORBI ATP synthase subunit beta, chloroplastic OS=Sorghum bicolor GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|A6W3S8|ATPB2_MARMS ATP synthase subunit beta 2 OS=Marinomonas sp. (strain MWYL1) GN=atpD2 PE=3 SV=1 13 465 0.0E+00
sp|A6L8P2|ATPB_PARD8 ATP synthase subunit beta OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=atpD PE=3 SV=1 18 465 0.0E+00
sp|A5WBW1|ATPB_PSYWF ATP synthase subunit beta OS=Psychrobacter sp. (strain PRwf-1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B0TQF4|ATPB_SHEHH ATP synthase subunit beta OS=Shewanella halifaxensis (strain HAW-EB4) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q0HPG1|ATPB_SHESR ATP synthase subunit beta OS=Shewanella sp. (strain MR-7) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q95FL8|ATPB_POPTM ATP synthase subunit beta, chloroplastic OS=Populus tremuloides GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A7Y3E6|ATPB_IPOPU ATP synthase subunit beta, chloroplastic OS=Ipomoea purpurea GN=atpB PE=3 SV=1 15 461 0.0E+00
sp|Q9XQX2|ATPB_TROAR ATP synthase subunit beta, chloroplastic OS=Trochodendron aralioides GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q8MBQ1|ATPB_IPOAQ ATP synthase subunit beta, chloroplastic OS=Ipomoea aquatica GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|A8G1W5|ATPB_SHESH ATP synthase subunit beta OS=Shewanella sediminis (strain HAW-EB3) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|P00828|ATPB_HORVU ATP synthase subunit beta, chloroplastic OS=Hordeum vulgare GN=atpB PE=3 SV=2 15 462 0.0E+00
sp|A9BFX3|ATPB_PETMO ATP synthase subunit beta OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q09G39|ATPB_PLAOC ATP synthase subunit beta, chloroplastic OS=Platanus occidentalis GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|P62614|ATPB_AEGCR ATP synthase subunit beta, chloroplastic OS=Aegilops crassa GN=atpB PE=3 SV=1 15 462 0.0E+00
sp|P62626|ATPB_AEGCO ATP synthase subunit beta, chloroplastic OS=Aegilops columnaris GN=atpB PE=3 SV=1 15 462 0.0E+00
sp|B0SLC8|ATPB_LEPBP ATP synthase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=atpD PE=3 SV=1 9 455 0.0E+00
sp|B0SDA5|ATPB_LEPBA ATP synthase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=atpD PE=3 SV=1 9 455 0.0E+00
sp|Q4VZI5|ATPB_CUCSA ATP synthase subunit beta, chloroplastic OS=Cucumis sativus GN=atpB PE=3 SV=2 15 472 0.0E+00
sp|Q09FV4|ATPB_NANDO ATP synthase subunit beta, chloroplastic OS=Nandina domestica GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q11Y90|ATPB_CYTH3 ATP synthase subunit beta OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=atpD PE=3 SV=1 22 471 0.0E+00
sp|Q7H8M1|ATPB_IPOSE ATP synthase subunit beta, chloroplastic OS=Ipomoea setosa GN=atpB PE=3 SV=1 15 461 0.0E+00
sp|Q8E8C0|ATPB_SHEON ATP synthase subunit beta OS=Shewanella oneidensis (strain MR-1) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q332X1|ATPB_LACSA ATP synthase subunit beta, chloroplastic OS=Lactuca sativa GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A4QL26|ATPB_DRANE ATP synthase subunit beta, chloroplastic OS=Draba nemorosa GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|A7MMW9|ATPB_CROS8 ATP synthase subunit beta OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q33C27|ATPB_NICTO ATP synthase subunit beta, chloroplastic OS=Nicotiana tomentosiformis GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A0M791|ATPB_GRAFK ATP synthase subunit beta OS=Gramella forsetii (strain KT0803) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q1QSD0|ATPB_CHRSD ATP synthase subunit beta OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B5RFW3|ATPB_SALG2 ATP synthase subunit beta OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|C6DJH2|ATPB_PECCP ATP synthase subunit beta OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A0A342|ATPB_COFAR ATP synthase subunit beta, chloroplastic OS=Coffea arabica GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A5GV55|ATPB_SYNR3 ATP synthase subunit beta OS=Synechococcus sp. (strain RCC307) GN=atpD PE=3 SV=1 6 468 0.0E+00
sp|Q8A9V4|ATPB_BACTN ATP synthase subunit beta OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=atpD PE=3 SV=1 22 471 0.0E+00
sp|A1EA15|ATPB_AGRST ATP synthase subunit beta, chloroplastic OS=Agrostis stolonifera GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|P20858|ATPB_WHEAT ATP synthase subunit beta, chloroplastic OS=Triticum aestivum GN=atpB PE=3 SV=1 13 462 0.0E+00
sp|Q3BAN5|ATPB_PHAAO ATP synthase subunit beta, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|Q7VA76|ATPB_PROMA ATP synthase subunit beta OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=atpD PE=3 SV=1 6 471 0.0E+00
sp|A8A6J5|ATPB_ECOHS ATP synthase subunit beta OS=Escherichia coli O9:H4 (strain HS) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B8D6S7|ATPB_BUCAT ATP synthase subunit beta OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P57124|ATPB_BUCAI ATP synthase subunit beta OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B8D8H3|ATPB_BUCA5 ATP synthase subunit beta OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q09MH1|ATPB_CITSI ATP synthase subunit beta, chloroplastic OS=Citrus sinensis GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|P00826|ATPB_TOBAC ATP synthase subunit beta, chloroplastic OS=Nicotiana tabacum GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q07VU4|ATPB1_SHEFN ATP synthase subunit beta 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=atpD1 PE=3 SV=1 15 464 0.0E+00
sp|Q2MI93|ATPB_SOLLC ATP synthase subunit beta, chloroplastic OS=Solanum lycopersicum GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q8MBQ3|ATPB_IPOQU ATP synthase subunit beta, chloroplastic OS=Ipomoea quamoclit GN=atpB PE=3 SV=1 15 461 0.0E+00
sp|P06284|ATPB_MARPO ATP synthase subunit beta, chloroplastic OS=Marchantia polymorpha GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|B0RWC2|ATPB_XANCB ATP synthase subunit beta OS=Xanthomonas campestris pv. campestris (strain B100) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q3YVN6|ATPB_SHISS ATP synthase subunit beta OS=Shigella sonnei (strain Ss046) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P0ABB7|ATPB_SHIFL ATP synthase subunit beta OS=Shigella flexneri GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|Q0SYU4|ATPB_SHIF8 ATP synthase subunit beta OS=Shigella flexneri serotype 5b (strain 8401) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q31UN2|ATPB_SHIBS ATP synthase subunit beta OS=Shigella boydii serotype 4 (strain Sb227) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B2TUP3|ATPB_SHIB3 ATP synthase subunit beta OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7LK77|ATPB_ESCF3 ATP synthase subunit beta OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q1R4K2|ATPB_ECOUT ATP synthase subunit beta OS=Escherichia coli (strain UTI89 / UPEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B1LL59|ATPB_ECOSM ATP synthase subunit beta OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B6I3W9|ATPB_ECOSE ATP synthase subunit beta OS=Escherichia coli (strain SE11) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7NF48|ATPB_ECOLU ATP synthase subunit beta OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P0ABB4|ATPB_ECOLI ATP synthase subunit beta OS=Escherichia coli (strain K12) GN=atpD PE=1 SV=2 15 465 0.0E+00
sp|B1IX06|ATPB_ECOLC ATP synthase subunit beta OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P0ABB5|ATPB_ECOL6 ATP synthase subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|Q0TAX7|ATPB_ECOL5 ATP synthase subunit beta OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A1AHR4|ATPB_ECOK1 ATP synthase subunit beta OS=Escherichia coli O1:K1 / APEC GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B1X9W0|ATPB_ECODH ATP synthase subunit beta OS=Escherichia coli (strain K12 / DH10B) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|C4ZZ10|ATPB_ECOBW ATP synthase subunit beta OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7M588|ATPB_ECO8A ATP synthase subunit beta OS=Escherichia coli O8 (strain IAI1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7N2H1|ATPB_ECO81 ATP synthase subunit beta OS=Escherichia coli O81 (strain ED1a) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7NR34|ATPB_ECO7I ATP synthase subunit beta OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B5YXD6|ATPB_ECO5E ATP synthase subunit beta OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|P0ABB6|ATPB_ECO57 ATP synthase subunit beta OS=Escherichia coli O157:H7 GN=atpD PE=3 SV=2 15 465 0.0E+00
sp|B7L882|ATPB_ECO55 ATP synthase subunit beta OS=Escherichia coli (strain 55989 / EAEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7MGF2|ATPB_ECO45 ATP synthase subunit beta OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B7UMJ7|ATPB_ECO27 ATP synthase subunit beta OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A7ZTU4|ATPB_ECO24 ATP synthase subunit beta OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q7CPE2|ATPB_SALTY ATP synthase subunit beta OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q8XGX4|ATPB_SALTI ATP synthase subunit beta OS=Salmonella typhi GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B4TN31|ATPB_SALSV ATP synthase subunit beta OS=Salmonella schwarzengrund (strain CVM19633) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|C0Q2N2|ATPB_SALPC ATP synthase subunit beta OS=Salmonella paratyphi C (strain RKS4594) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A9MXA6|ATPB_SALPB ATP synthase subunit beta OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B4SYD1|ATPB_SALNS ATP synthase subunit beta OS=Salmonella newport (strain SL254) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B4TAX2|ATPB_SALHS ATP synthase subunit beta OS=Salmonella heidelberg (strain SL476) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B5QUS4|ATPB_SALEP ATP synthase subunit beta OS=Salmonella enteritidis PT4 (strain P125109) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B5FN33|ATPB_SALDC ATP synthase subunit beta OS=Salmonella dublin (strain CT_02021853) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q57HX9|ATPB_SALCH ATP synthase subunit beta OS=Salmonella choleraesuis (strain SC-B67) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A9MJR9|ATPB_SALAR ATP synthase subunit beta OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|B5EYZ6|ATPB_SALA4 ATP synthase subunit beta OS=Salmonella agona (strain SL483) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A4GG90|ATPB_PHAVU ATP synthase subunit beta, chloroplastic OS=Phaseolus vulgaris GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|P69370|ATPB_NICPL ATP synthase subunit beta, chloroplastic OS=Nicotiana plumbaginifolia GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|P69369|ATPB_NICBI ATP synthase subunit beta, chloroplastic OS=Nicotiana bigelovii GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q85V26|ATPB_HYANO ATP synthase subunit beta, chloroplastic OS=Hyacinthoides non-scripta GN=atpB PE=3 SV=1 15 468 0.0E+00
sp|A4QLK1|ATPB_LOBMA ATP synthase subunit beta, chloroplastic OS=Lobularia maritima GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|P51259|ATPB_PORPU ATP synthase subunit beta, chloroplastic OS=Porphyra purpurea GN=atpB PE=3 SV=1 13 465 0.0E+00
sp|Q8PCZ5|ATPB_XANCP ATP synthase subunit beta OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q4UQF4|ATPB_XANC8 ATP synthase subunit beta OS=Xanthomonas campestris pv. campestris (strain 8004) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|A4QKJ9|ATPB_CAPBU ATP synthase subunit beta, chloroplastic OS=Capsella bursa-pastoris GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|A4QLU0|ATPB_NASOF ATP synthase subunit beta, chloroplastic OS=Nasturtium officinale GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q8DLG8|ATPB_THEEB ATP synthase subunit beta OS=Thermosynechococcus elongatus (strain BP-1) GN=atpD PE=1 SV=1 15 455 0.0E+00
sp|Q0ZJ13|ATPB_VITVI ATP synthase subunit beta, chloroplastic OS=Vitis vinifera GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q65Q07|ATPB_MANSM ATP synthase subunit beta OS=Mannheimia succiniciproducens (strain MBEL55E) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A5CVI6|ATPB_VESOH ATP synthase subunit beta OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q06GQ3|ATPB_PIPCE ATP synthase subunit beta, chloroplastic OS=Piper cenocladum GN=atpB PE=3 SV=1 13 461 0.0E+00
sp|A4QK25|ATPB_ARAHI ATP synthase subunit beta, chloroplastic OS=Arabis hirsuta GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|A9NBD0|ATPB_COXBR ATP synthase subunit beta OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q87E90|ATPB_XYLFT ATP synthase subunit beta OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|B2I877|ATPB_XYLF2 ATP synthase subunit beta OS=Xylella fastidiosa (strain M23) GN=atpD PE=3 SV=1 15 467 0.0E+00
sp|Q2L917|ATPB_GOSHI ATP synthase subunit beta, chloroplastic OS=Gossypium hirsutum GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|B0UWG5|ATPB_HISS2 ATP synthase subunit beta OS=Histophilus somni (strain 2336) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q83AF5|ATPB_COXBU ATP synthase subunit beta OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A9KBF7|ATPB_COXBN ATP synthase subunit beta OS=Coxiella burnetii (strain Dugway 5J108-111) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q3SF66|ATPB_THIDA ATP synthase subunit beta OS=Thiobacillus denitrificans (strain ATCC 25259) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q6EW72|ATPB_NYMAL ATP synthase subunit beta, chloroplastic OS=Nymphaea alba GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q0G9V5|ATPB_DAUCA ATP synthase subunit beta, chloroplastic OS=Daucus carota GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|A8SEB0|ATPB_CERDE ATP synthase subunit beta, chloroplastic OS=Ceratophyllum demersum GN=atpB PE=3 SV=1 15 461 0.0E+00
sp|P13356|ATPB_BACFR ATP synthase subunit beta OS=Bacteroides fragilis (strain YCH46) GN=atpD PE=3 SV=2 22 471 0.0E+00
sp|Q5LD89|ATPB_BACFN ATP synthase subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=atpD PE=3 SV=1 22 471 0.0E+00
sp|B2VCA4|ATPB_ERWT9 ATP synthase subunit beta OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q2STE9|ATPB1_BURTA ATP synthase subunit beta 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=atpD1 PE=1 SV=1 15 465 0.0E+00
sp|Q63PI0|ATPB1_BURPS ATP synthase subunit beta 1 OS=Burkholderia pseudomallei (strain K96243) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|A3NF40|ATPB1_BURP6 ATP synthase subunit beta 1 OS=Burkholderia pseudomallei (strain 668) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|Q3JXV8|ATPB1_BURP1 ATP synthase subunit beta 1 OS=Burkholderia pseudomallei (strain 1710b) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|A3P0Z0|ATPB1_BURP0 ATP synthase subunit beta 1 OS=Burkholderia pseudomallei (strain 1106a) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|A1V8T1|ATPB1_BURMS ATP synthase subunit beta 1 OS=Burkholderia mallei (strain SAVP1) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|Q62FR5|ATPB1_BURMA ATP synthase subunit beta 1 OS=Burkholderia mallei (strain ATCC 23344) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|A3MQJ9|ATPB1_BURM7 ATP synthase subunit beta 1 OS=Burkholderia mallei (strain NCTC 10247) GN=atpD1 PE=3 SV=1 15 465 0.0E+00
sp|Q9MRF3|ATPB_IDIAU ATP synthase subunit beta, chloroplastic OS=Idiospermum australiense GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q9MU43|ATPB_LIRTU ATP synthase subunit beta, chloroplastic OS=Liriodendron tulipifera GN=atpB PE=3 SV=2 15 471 0.0E+00
sp|B8CVU5|ATPB_SHEPW ATP synthase subunit beta OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q8S8W8|ATPB_ATRBE ATP synthase subunit beta, chloroplastic OS=Atropa belladonna GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q9TKI7|ATPB_MEDSA ATP synthase subunit beta, chloroplastic OS=Medicago sativa GN=atpB PE=3 SV=1 13 465 0.0E+00
sp|Q6LKZ6|ATPB2_PHOPR ATP synthase subunit beta 2 OS=Photobacterium profundum GN=atpD2 PE=3 SV=1 15 465 0.0E+00
sp|Q9K6H5|ATPB_BACHD ATP synthase subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=atpD PE=3 SV=1 15 466 0.0E+00
sp|A4QKT8|ATPB_CRUWA ATP synthase subunit beta, chloroplastic OS=Crucihimalaya wallichii GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|A9AJG4|ATPB_BURM1 ATP synthase subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q9MS49|ATPB_BRANA ATP synthase subunit beta, chloroplastic OS=Brassica napus GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|B5BIN6|ATPB_SALPK ATP synthase subunit beta OS=Salmonella paratyphi A (strain AKU_12601) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q5PKX2|ATPB_SALPA ATP synthase subunit beta OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|Q9MRR9|ATPB_BRASC ATP synthase subunit beta, chloroplastic OS=Brasenia schreberi GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q9MU41|ATPB_MAGTR ATP synthase subunit beta, chloroplastic OS=Magnolia tripetala GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|A6MMC9|ATPB_CHLSC ATP synthase subunit beta, chloroplastic OS=Chloranthus spicatus GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q8MBM4|ATPB_CALSE ATP synthase subunit beta, chloroplastic OS=Calystegia sepium GN=atpB PE=3 SV=1 15 461 0.0E+00
sp|Q12HQ1|ATPB_SHEDO ATP synthase subunit beta OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|P26530|ATPB_NICRU ATP synthase subunit beta, chloroplastic OS=Nicotiana rustica GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|P26531|ATPB_NICSP ATP synthase subunit beta, chloroplastic OS=Nicotiana sp. GN=atpB PE=3 SV=1 15 472 0.0E+00
sp|Q8PGG7|ATPB_XANAC ATP synthase subunit beta OS=Xanthomonas axonopodis pv. citri (strain 306) GN=atpD PE=3 SV=1 15 468 0.0E+00
sp|Q9MRI8|ATPB_GALBE ATP synthase subunit beta, chloroplastic OS=Galbulimima belgraveana GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|A4QKB2|ATPB_BARVE ATP synthase subunit beta, chloroplastic OS=Barbarea verna GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|A6MM43|ATPB_BUXMI ATP synthase subunit beta, chloroplastic OS=Buxus microphylla GN=atpB PE=3 SV=1 15 471 0.0E+00
sp|Q3K441|ATPB_PSEPF ATP synthase subunit beta OS=Pseudomonas fluorescens (strain Pf0-1) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A2S6J8|ATPB_BURM9 ATP synthase subunit beta OS=Burkholderia mallei (strain NCTC 10229) GN=atpD PE=3 SV=1 15 465 0.0E+00
sp|A9KX06|ATPB_SHEB9 ATP synthase subunit beta OS=Shewanella baltica (strain OS195) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A6WUJ0|ATPB_SHEB8 ATP synthase subunit beta OS=Shewanella baltica (strain OS185) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|A3DAR4|ATPB_SHEB5 ATP synthase subunit beta OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|B8EDV0|ATPB_SHEB2 ATP synthase subunit beta OS=Shewanella baltica (strain OS223) GN=atpD PE=3 SV=1 15 464 0.0E+00
sp|Q8MBQ2|ATPB_IPOWR ATP synthase subunit beta, chloroplastic OS=Ipomoea wrightii GN=atpB PE=3 SV=1 15 461 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:1902600 proton transmembrane transport Yes
GO:0046034 ATP metabolic process Yes
GO:0005524 ATP binding Yes
GO:0006807 nitrogen compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0032553 ribonucleotide binding No
GO:0009259 ribonucleotide metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0051179 localization No
GO:0098655 cation transmembrane transport No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0017076 purine nucleotide binding No
GO:1901135 carbohydrate derivative metabolic process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0019693 ribose phosphate metabolic process No
GO:0008150 biological_process No
GO:0006812 cation transport No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006811 ion transport No
GO:0055085 transmembrane transport No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0051234 establishment of localization No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0034220 ion transmembrane transport No
GO:0072521 purine-containing compound metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0098660 inorganic ion transmembrane transport No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006163 purine nucleotide metabolic process No
GO:0044237 cellular metabolic process No
GO:0098662 inorganic cation transmembrane transport No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2508
MAKFTRSSVPSSMAVKFDTAKLPPILNSLETTNNGQKLVLEVAQHLGENVVRCIAMDGTEGLVRGAKATDTGAPI
TIPVGPATLGRIMNVTGDPIDERGPIKTDKFLPIHAEPPAFIDQSTSAEILVTGIKVVDLLAPYARGGKIGLFGG
AGVGKTVFIQELINNIAKAHGGYSVFTGVGERTREGNDLYHEMQETSVIQLDGDSKVALVFGQMNEPPGARARVA
LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLAVDMGGMQERITTTKKGSITSVQ
AVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSTSRMLDPRLVGQEHYDTATRVQQILQEYKG
LQDIIAILGMDELSEADKLTVERARKIQRFLSQPFTVAQVFTGIEGKLVDLKDTIASFKAILSGEGDDLPEGAFY
MVGDLASAKQKGEKILAELEKN*
Coding >OphauB2|2508
ATGGCAAAATTCACCAGGTCATCGGTGCCGTCGTCGATGGCAGTCAAATTCGACACTGCCAAGCTGCCCCCTATT
CTAAATTCGCTCGAGACAACCAACAATGGTCAGAAGCTCGTGCTCGAGGTCGCACAACATCTCGGCGAGAATGTT
GTCCGCTGCATTGCCATGGACGGTACTGAAGGTCTCGTTCGAGGGGCCAAAGCCACCGACACGGGTGCTCCCATC
ACCATCCCCGTCGGCCCTGCCACTCTTGGTCGTATCATGAATGTCACTGGCGATCCAATCGACGAGCGTGGGCCC
ATCAAGACGGACAAATTCCTGCCTATCCACGCTGAGCCCCCGGCCTTCATTGATCAGTCTACCTCTGCCGAGATT
TTGGTTACCGGCATCAAGGTCGTTGATCTTCTGGCTCCTTATGCTCGTGGTGGCAAGATTGGCCTGTTTGGCGGT
GCTGGTGTCGGAAAAACAGTCTTCATCCAGGAGCTTATCAACAATATCGCCAAGGCTCACGGTGGTTACTCCGTC
TTCACCGGCGTCGGCGAGCGTACCCGTGAAGGAAATGACTTGTACCACGAAATGCAGGAGACATCGGTCATTCAG
CTAGACGGTGACTCCAAGGTTGCACTGGTCTTTGGTCAGATGAACGAGCCCCCAGGCGCTCGTGCCCGTGTCGCT
CTGACGGGTTTAACTGTTGCTGAATACTTCCGTGACCAAGAAGGACAGGACGTGCTGCTCTTTATCGACAATATT
TTCCGCTTCACTCAGGCCGGTTCCGAGGTGTCTGCTCTGCTGGGTCGTATCCCCTCGGCCGTCGGGTACCAGCCC
ACTCTCGCCGTCGACATGGGTGGCATGCAGGAACGCATCACAACCACCAAGAAGGGTTCCATTACGTCGGTCCAG
GCCGTTTACGTTCCTGCCGACGACTTGACTGACCCTGCTCCTGCAACAACCTTTGCTCACTTGGACGCTACCACT
GTCTTGTCTCGTGGTATTTCCGAACTGGGTATCTATCCTGCTGTCGACCCTTTGGACTCGACTTCGCGTATGCTT
GATCCTCGTCTTGTCGGCCAGGAACACTACGACACGGCTACACGCGTTCAGCAGATTCTCCAGGAGTACAAGGGC
CTCCAGGATATCATTGCCATTCTTGGAATGGATGAGTTGTCTGAAGCTGACAAGCTCACAGTCGAGCGGGCCCGT
AAAATCCAGCGTTTCCTGAGCCAGCCGTTTACTGTGGCTCAAGTCTTCACGGGTATTGAGGGCAAGCTAGTGGAC
CTCAAGGACACTATTGCCTCATTCAAGGCCATTCTTAGCGGCGAGGGCGATGATTTGCCCGAGGGTGCTTTCTAC
ATGGTTGGCGACCTGGCATCAGCTAAGCAGAAGGGAGAAAAGATTCTCGCAGAACTAGAGAAGAACTAG
Transcript >OphauB2|2508
ATGGCAAAATTCACCAGGTCATCGGTGCCGTCGTCGATGGCAGTCAAATTCGACACTGCCAAGCTGCCCCCTATT
CTAAATTCGCTCGAGACAACCAACAATGGTCAGAAGCTCGTGCTCGAGGTCGCACAACATCTCGGCGAGAATGTT
GTCCGCTGCATTGCCATGGACGGTACTGAAGGTCTCGTTCGAGGGGCCAAAGCCACCGACACGGGTGCTCCCATC
ACCATCCCCGTCGGCCCTGCCACTCTTGGTCGTATCATGAATGTCACTGGCGATCCAATCGACGAGCGTGGGCCC
ATCAAGACGGACAAATTCCTGCCTATCCACGCTGAGCCCCCGGCCTTCATTGATCAGTCTACCTCTGCCGAGATT
TTGGTTACCGGCATCAAGGTCGTTGATCTTCTGGCTCCTTATGCTCGTGGTGGCAAGATTGGCCTGTTTGGCGGT
GCTGGTGTCGGAAAAACAGTCTTCATCCAGGAGCTTATCAACAATATCGCCAAGGCTCACGGTGGTTACTCCGTC
TTCACCGGCGTCGGCGAGCGTACCCGTGAAGGAAATGACTTGTACCACGAAATGCAGGAGACATCGGTCATTCAG
CTAGACGGTGACTCCAAGGTTGCACTGGTCTTTGGTCAGATGAACGAGCCCCCAGGCGCTCGTGCCCGTGTCGCT
CTGACGGGTTTAACTGTTGCTGAATACTTCCGTGACCAAGAAGGACAGGACGTGCTGCTCTTTATCGACAATATT
TTCCGCTTCACTCAGGCCGGTTCCGAGGTGTCTGCTCTGCTGGGTCGTATCCCCTCGGCCGTCGGGTACCAGCCC
ACTCTCGCCGTCGACATGGGTGGCATGCAGGAACGCATCACAACCACCAAGAAGGGTTCCATTACGTCGGTCCAG
GCCGTTTACGTTCCTGCCGACGACTTGACTGACCCTGCTCCTGCAACAACCTTTGCTCACTTGGACGCTACCACT
GTCTTGTCTCGTGGTATTTCCGAACTGGGTATCTATCCTGCTGTCGACCCTTTGGACTCGACTTCGCGTATGCTT
GATCCTCGTCTTGTCGGCCAGGAACACTACGACACGGCTACACGCGTTCAGCAGATTCTCCAGGAGTACAAGGGC
CTCCAGGATATCATTGCCATTCTTGGAATGGATGAGTTGTCTGAAGCTGACAAGCTCACAGTCGAGCGGGCCCGT
AAAATCCAGCGTTTCCTGAGCCAGCCGTTTACTGTGGCTCAAGTCTTCACGGGTATTGAGGGCAAGCTAGTGGAC
CTCAAGGACACTATTGCCTCATTCAAGGCCATTCTTAGCGGCGAGGGCGATGATTTGCCCGAGGGTGCTTTCTAC
ATGGTTGGCGACCTGGCATCAGCTAAGCAGAAGGGAGAAAAGATTCTCGCAGAACTAGAGAAGAACTAG
Gene >OphauB2|2508
ATGGCAAAATTCACCAGGTGAAGCTGTTTCCGCCCCTGCCGAGCCGGGATTATGGGCTGACCCAAGTACCTCGAT
AGGTCATCGGTGCCGTCGTCGATGGTCAGTCAATCCGCCCCTCTTGTGCGCCTCTGCTGAAAGCACTTTTTGCTG
ATGTTTGAGGCAGTCAAATTCGACACTGCCAAGCTGCCCCCTATTCTAAATTCGCTCGAGACAACCAACAATGGT
CAGAAGCTCGTGCTCGAGGTCGCAGTACGCGCTTTTGTCCAAGTCTGGTCGATTATCATGGATACTGATGGCTTG
GTCAGCAACATCTCGGCGAGAATGTTGTCCGCTGCATTGCCATGGACGGTATGCCATTGCTCACGCCACTGGCTT
ATTGAAGCTGTTGCCTAATGCCTTGCAGGTACTGAAGGTCTCGTTCGAGGGGCCAAAGCCACCGACACGGGTGCT
CCCATCACCATCCCCGTCGGCCCTGCCACTCTTGGTCGTATCATGAATGTCACTGGCGATCCAATCGACGAGCGT
GGGCCCATCAAGACGGACAAATTCCTGCCTATCCACGCTGAGCCCCCGGCCTTCATTGATCAGTCTACCTCTGCC
GAGATTTTGGTTACCGGCATCAAGGTCGTTGATCTTCTGGCTCCTTATGCTCGTGGTGGCAAGATTGGCCTGTTT
GGCGGTGCTGGTGTCGGAAAAACAGTCTTCATCCAGGAGCTTATCAACAATATCGCCAAGGCTCACGGTGGTTAC
TCCGTCTTCACCGGCGTCGGCGAGCGTACCCGTGAAGGAAATGACTTGTACCACGAAATGCAGGAGACATCGGTC
ATTCAGCTAGACGGTGACTCCAAGGTTGCACTGGTCTTTGGTCAGATGAACGAGCCCCCAGGCGCTCGTGCCCGT
GTCGCTCTGACGGGTTTAACTGTTGCTGAATACTTCCGTGACCAAGAAGGACAGGACGGTACGTTGGGAACTGCT
TATAGGCTCCGCGTATAAATGCTGATGTTGAATGTCCAACAGTGCTGCTCTTTATCGACAATATTTTCCGCTTCA
CTCAGGCCGGTTCCGAGGTGTCTGCTCTGCTGGGTCGTATCCCCTCGGCCGTCGGGTACCAGCCCACTCTCGCCG
TCGACATGGGTGGCATGCAGGAACGCATCACAACCACCAAGAAGGGTTCCATTACGTCGGTCCAGGCCGTTTACG
TTCCTGCCGACGACTTGACTGACCCTGCTCCTGCAACAACCTTTGCTCACTTGGACGCTACCACTGTCTTGTCTC
GTGGTATTTCCGAACTGGGTATCTATCCTGCTGTCGACCCTTTGGACTCGACTTCGCGTATGCTTGATCCTCGTC
TTGTCGGCCAGGAACACTACGACACGGCTACACGCGTTCAGCAGATTCTCCAGGAGTACAAGGGCCTCCAGGATA
TCATTGCCATTCTTGGAATGGATGAGTTGTCTGAAGCTGACAAGCTCACAGTCGAGCGGGCCCGTAAAATCCAGC
GTTTCCTGAGCCAGCCGTTTACTGTGGCTCAAGTCTTCACGGGTATTGAGGGCAAGCTAGTGGACCTCAAGGACA
CTATTGCCTCATTCAAGGCCATTCTTAGCGGCGAGGGCGATGATTTGCCCGAGGGTGCTTTCTACATGGTTGGCG
ACCTGGCATCAGCTAAGCAGAAGGGAGAAAAGATTCTCGCAGAACTAGAGAAGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail