Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2505
Gene name
LocationContig_18:111874..114959
Strand-
Gene length (bp)3085
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02779 Transket_pyr Transketolase, pyrimidine binding domain 8.4E-63 555 767
PF00676 E1_dh Dehydrogenase E1 component 4.6E-57 166 482
PF16870 OxoGdeHyase_C 2-oxoglutarate dehydrogenase C-terminal 3.6E-54 771 924
PF16078 2-oxogl_dehyd_N 2-oxoglutarate dehydrogenase N-terminus 3.8E-11 26 53

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74378|ODO1_SCHPO 2-oxoglutarate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kgd1 PE=3 SV=1 21 924 0.0E+00
sp|P20967|ODO1_YEAST 2-oxoglutarate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KGD1 PE=1 SV=2 25 924 0.0E+00
sp|Q54JE4|ODO1_DICDI 2-oxoglutarate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=ogdh PE=3 SV=1 25 925 0.0E+00
sp|Q623T0|ODO1_CAEBR 2-oxoglutarate dehydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=ogdh-1 PE=3 SV=1 28 933 0.0E+00
sp|O61199|ODO1_CAEEL 2-oxoglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=ogdh-1 PE=1 SV=2 1 933 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74378|ODO1_SCHPO 2-oxoglutarate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kgd1 PE=3 SV=1 21 924 0.0E+00
sp|P20967|ODO1_YEAST 2-oxoglutarate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KGD1 PE=1 SV=2 25 924 0.0E+00
sp|Q54JE4|ODO1_DICDI 2-oxoglutarate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=ogdh PE=3 SV=1 25 925 0.0E+00
sp|Q623T0|ODO1_CAEBR 2-oxoglutarate dehydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=ogdh-1 PE=3 SV=1 28 933 0.0E+00
sp|O61199|ODO1_CAEEL 2-oxoglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=ogdh-1 PE=1 SV=2 1 933 0.0E+00
sp|Q148N0|ODO1_BOVIN 2-oxoglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=OGDH PE=2 SV=1 2 924 0.0E+00
sp|Q60HE2|ODO1_MACFA 2-oxoglutarate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=OGDH PE=2 SV=1 3 924 0.0E+00
sp|Q02218|ODO1_HUMAN 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=OGDH PE=1 SV=3 3 924 0.0E+00
sp|Q5RCB8|ODO1_PONAB 2-oxoglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=OGDH PE=2 SV=1 3 924 0.0E+00
sp|Q9ULD0|OGDHL_HUMAN 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Homo sapiens GN=OGDHL PE=1 SV=3 36 927 0.0E+00
sp|Q5R9L8|OGDHL_PONAB 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Pongo abelii GN=OGDHL PE=2 SV=2 36 927 0.0E+00
sp|Q68EW0|OGDHL_XENLA 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Xenopus laevis GN=ogdhl PE=2 SV=1 28 927 0.0E+00
sp|Q5XI78|ODO1_RAT 2-oxoglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Ogdh PE=1 SV=1 134 924 0.0E+00
sp|Q6P6Z8|ODO1_XENLA 2-oxoglutarate dehydrogenase, mitochondrial OS=Xenopus laevis GN=ogdh PE=2 SV=1 81 933 0.0E+00
sp|Q60597|ODO1_MOUSE 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=Ogdh PE=1 SV=3 134 924 0.0E+00
sp|A6WXF0|ODO1_OCHA4 2-oxoglutarate dehydrogenase E1 component OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|Q8FYF7|ODO1_BRUSU 2-oxoglutarate dehydrogenase E1 component OS=Brucella suis biovar 1 (strain 1330) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|A9M8Q9|ODO1_BRUC2 2-oxoglutarate dehydrogenase E1 component OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|B0CIS7|ODO1_BRUSI 2-oxoglutarate dehydrogenase E1 component OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|Q57AX5|ODO1_BRUAB 2-oxoglutarate dehydrogenase E1 component OS=Brucella abortus biovar 1 (strain 9-941) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|Q2YLS2|ODO1_BRUA2 2-oxoglutarate dehydrogenase E1 component OS=Brucella abortus (strain 2308) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|B2S877|ODO1_BRUA1 2-oxoglutarate dehydrogenase E1 component OS=Brucella abortus (strain S19) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|A5VSQ0|ODO1_BRUO2 2-oxoglutarate dehydrogenase E1 component OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|Q8YJE4|ODO1_BRUME 2-oxoglutarate dehydrogenase E1 component OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|C0RFG8|ODO1_BRUMB 2-oxoglutarate dehydrogenase E1 component OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=sucA PE=3 SV=1 95 924 0.0E+00
sp|Q8F6S7|ODO1_LEPIN 2-oxoglutarate dehydrogenase E1 component OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=sucA PE=3 SV=1 137 924 0.0E+00
sp|Q72PJ7|ODO1_LEPIC 2-oxoglutarate dehydrogenase E1 component OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=sucA PE=3 SV=1 137 924 0.0E+00
sp|P20707|ODO1_AZOVI 2-oxoglutarate dehydrogenase E1 component OS=Azotobacter vinelandii GN=sucA PE=3 SV=1 93 926 0.0E+00
sp|Q59106|ODO1_CUPNH 2-oxoglutarate dehydrogenase E1 component OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=odhA PE=3 SV=2 25 933 0.0E+00
sp|A0PVU7|KGD_MYCUA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium ulcerans (strain Agy99) GN=kgd PE=3 SV=1 138 924 0.0E+00
sp|A0R2B1|KGD_MYCS2 Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kgd PE=1 SV=1 95 924 0.0E+00
sp|Q1B4V6|KGD_MYCSS Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain MCS) GN=kgd PE=3 SV=1 138 925 0.0E+00
sp|A1UK81|KGD_MYCSK Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain KMS) GN=kgd PE=3 SV=1 138 925 0.0E+00
sp|A3Q3N5|KGD_MYCSJ Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium sp. (strain JLS) GN=kgd PE=3 SV=1 138 925 0.0E+00
sp|Q73WX4|KGD_MYCPA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=kgd PE=3 SV=1 137 925 0.0E+00
sp|A1KI36|KGD_MYCBP Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kgd PE=3 SV=2 137 924 0.0E+00
sp|Q7U0A6|KGD_MYCBO Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kgd PE=3 SV=2 137 924 0.0E+00
sp|P9WIS5|KGD_MYCTU Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kgd PE=1 SV=1 137 924 0.0E+00
sp|P9WIS4|KGD_MYCTO Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kgd PE=3 SV=1 137 924 0.0E+00
sp|A5U1U6|KGD_MYCTA Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kgd PE=3 SV=2 137 924 0.0E+00
sp|P0AFG3|ODO1_ECOLI 2-oxoglutarate dehydrogenase E1 component OS=Escherichia coli (strain K12) GN=sucA PE=1 SV=1 138 927 0.0E+00
sp|P0AFG4|ODO1_ECOL6 2-oxoglutarate dehydrogenase E1 component OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sucA PE=3 SV=1 138 927 0.0E+00
sp|P0AFG5|ODO1_ECO57 2-oxoglutarate dehydrogenase E1 component OS=Escherichia coli O157:H7 GN=sucA PE=3 SV=1 138 927 0.0E+00
sp|Q9CC97|KGD_MYCLE Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium leprae (strain TN) GN=kgd PE=3 SV=2 137 924 0.0E+00
sp|Q4UKI8|ODO1_RICFE 2-oxoglutarate dehydrogenase E1 component OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucA PE=3 SV=2 137 924 0.0E+00
sp|Q8NRC3|ODO12_CORGL 2-oxoglutarate dehydrogenase E1/E2 component OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=odhA PE=1 SV=2 94 924 0.0E+00
sp|A1TDK2|KGD_MYCVP Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=kgd PE=3 SV=2 95 924 0.0E+00
sp|Q1RHI4|ODO1_RICBR 2-oxoglutarate dehydrogenase E1 component OS=Rickettsia bellii (strain RML369-C) GN=sucA PE=3 SV=1 28 927 0.0E+00
sp|Q92J42|ODO1_RICCN 2-oxoglutarate dehydrogenase E1 component OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucA PE=3 SV=1 137 926 0.0E+00
sp|Q68XI7|ODO1_RICTY 2-oxoglutarate dehydrogenase E1 component OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucA PE=3 SV=1 137 924 0.0E+00
sp|P45303|ODO1_HAEIN 2-oxoglutarate dehydrogenase E1 component OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucA PE=3 SV=1 29 925 0.0E+00
sp|P51056|ODO1_COXBU 2-oxoglutarate dehydrogenase E1 component OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sucA PE=3 SV=3 26 926 0.0E+00
sp|Q9ZDY3|ODO1_RICPR 2-oxoglutarate dehydrogenase E1 component OS=Rickettsia prowazekii (strain Madrid E) GN=sucA PE=3 SV=1 137 924 0.0E+00
sp|Q54VG0|DHTK1_DICDI Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 homolog, mitochondrial OS=Dictyostelium discoideum GN=odhA PE=3 SV=1 138 924 0.0E+00
sp|Q9VA02|DHTK1_DROME Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 homolog, mitochondrial OS=Drosophila melanogaster GN=CG1544 PE=2 SV=2 137 926 0.0E+00
sp|Q8K9N3|ODO1_BUCAP 2-oxoglutarate dehydrogenase E1 component OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=sucA PE=3 SV=1 155 927 0.0E+00
sp|C4L3W2|ODO1_EXISA 2-oxoglutarate dehydrogenase E1 component OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=odhA PE=3 SV=1 31 925 0.0E+00
sp|C5D802|ODO1_GEOSW 2-oxoglutarate dehydrogenase E1 component OS=Geobacillus sp. (strain WCH70) GN=odhA PE=3 SV=1 154 928 0.0E+00
sp|P57388|ODO1_BUCAI 2-oxoglutarate dehydrogenase E1 component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=sucA PE=3 SV=1 151 926 0.0E+00
sp|Q65IH4|ODO1_BACLD 2-oxoglutarate dehydrogenase E1 component OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=odhA PE=3 SV=1 31 927 0.0E+00
sp|Q23629|DHTK1_CAEEL Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 homolog, mitochondrial OS=Caenorhabditis elegans GN=ZK836.2 PE=3 SV=4 126 925 0.0E+00
sp|A8FE66|ODO1_BACP2 2-oxoglutarate dehydrogenase E1 component OS=Bacillus pumilus (strain SAFR-032) GN=odhA PE=3 SV=1 31 927 0.0E+00
sp|Q5L172|ODO1_GEOKA 2-oxoglutarate dehydrogenase E1 component OS=Geobacillus kaustophilus (strain HTA426) GN=odhA PE=3 SV=1 31 925 0.0E+00
sp|P23129|ODO1_BACSU 2-oxoglutarate dehydrogenase E1 component OS=Bacillus subtilis (strain 168) GN=odhA PE=3 SV=3 31 927 0.0E+00
sp|Q6P286|DHTK1_XENLA Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Xenopus laevis GN=dhtkd1 PE=2 SV=1 137 919 0.0E+00
sp|Q89AJ7|ODO1_BUCBP Oxoglutarate dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=sucA PE=3 SV=1 137 926 0.0E+00
sp|Q5PRA2|DHTK1_DANRE Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Danio rerio GN=dhtkd1 PE=2 SV=2 137 925 0.0E+00
sp|Q96HY7|DHTK1_HUMAN Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Homo sapiens GN=DHTKD1 PE=1 SV=2 137 925 0.0E+00
sp|A7Z5J9|ODO1_BACMF 2-oxoglutarate dehydrogenase E1 component OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=odhA PE=3 SV=1 31 927 0.0E+00
sp|Q5R7H0|DHTK1_PONAB Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Pongo abelii GN=DHTKD1 PE=2 SV=1 137 925 0.0E+00
sp|A2ATU0|DHTK1_MOUSE Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Mus musculus GN=Dhtkd1 PE=1 SV=1 137 925 0.0E+00
sp|Q4KLP0|DHTK1_RAT Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial OS=Rattus norvegicus GN=Dhtkd1 PE=2 SV=1 137 925 0.0E+00
sp|Q4L6C4|ODO1_STAHJ 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus haemolyticus (strain JCSC1435) GN=odhA PE=3 SV=1 138 924 2.0E-180
sp|A7GMD4|ODO1_BACCN 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=odhA PE=3 SV=1 138 930 1.0E-176
sp|Q8CUL8|ODO1_OCEIH 2-oxoglutarate dehydrogenase E1 component OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=odhA PE=3 SV=1 152 924 3.0E-176
sp|Q931R8|ODO1_STAAM 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=odhA PE=3 SV=2 138 924 5.0E-176
sp|A5ISU5|ODO1_STAA9 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain JH9) GN=odhA PE=3 SV=1 138 924 5.0E-176
sp|A6U1N4|ODO1_STAA2 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain JH1) GN=odhA PE=3 SV=1 138 924 5.0E-176
sp|A7X295|ODO1_STAA1 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=odhA PE=3 SV=1 138 924 5.0E-176
sp|Q6GGZ5|ODO1_STAAR 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain MRSA252) GN=odhA PE=3 SV=1 138 924 6.0E-176
sp|Q8NWR6|ODO1_STAAW 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain MW2) GN=odhA PE=3 SV=1 138 924 2.0E-175
sp|Q9KAT1|ODO1_BACHD 2-oxoglutarate dehydrogenase E1 component OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=odhA PE=3 SV=1 19 925 2.0E-175
sp|A8Z3Z0|ODO1_STAAT 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=odhA PE=3 SV=1 138 924 2.0E-175
sp|Q6G9E8|ODO1_STAAS 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain MSSA476) GN=odhA PE=3 SV=1 138 924 2.0E-175
sp|A6QGW6|ODO1_STAAE 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain Newman) GN=odhA PE=3 SV=1 138 924 2.0E-175
sp|Q5HG06|ODO1_STAAC 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain COL) GN=odhA PE=3 SV=1 138 924 2.0E-175
sp|Q2FYM1|ODO1_STAA8 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain NCTC 8325) GN=odhA PE=3 SV=1 138 924 2.0E-175
sp|Q2FH25|ODO1_STAA3 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain USA300) GN=odhA PE=3 SV=1 138 924 2.0E-175
sp|Q99U74|ODO1_STAAN 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain N315) GN=odhA PE=1 SV=1 138 924 3.0E-175
sp|P0C601|ODO1_STAAU 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus GN=odhA PE=3 SV=1 138 924 4.0E-175
sp|A9VJX9|ODO1_BACWK 2-oxoglutarate dehydrogenase E1 component OS=Bacillus weihenstephanensis (strain KBAB4) GN=odhA PE=3 SV=1 138 930 2.0E-174
sp|Q81TK1|ODO1_BACAN 2-oxoglutarate dehydrogenase E1 component OS=Bacillus anthracis GN=odhA PE=3 SV=1 138 934 2.0E-174
sp|C3LAU3|ODO1_BACAC 2-oxoglutarate dehydrogenase E1 component OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=odhA PE=3 SV=1 138 934 2.0E-174
sp|C3P487|ODO1_BACAA 2-oxoglutarate dehydrogenase E1 component OS=Bacillus anthracis (strain A0248) GN=odhA PE=3 SV=1 138 934 2.0E-174
sp|Q73BN8|ODO1_BACC1 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=odhA PE=3 SV=1 138 934 3.0E-174
sp|Q6HLS8|ODO1_BACHK 2-oxoglutarate dehydrogenase E1 component OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=odhA PE=3 SV=1 138 934 5.0E-174
sp|Q63EB1|ODO1_BACCZ 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain ZK / E33L) GN=odhA PE=3 SV=1 138 934 8.0E-174
sp|B7JEU9|ODO1_BACC0 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain AH820) GN=odhA PE=3 SV=1 138 934 8.0E-174
sp|Q81GF2|ODO1_BACCR 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=odhA PE=3 SV=1 138 930 9.0E-174
sp|B7IM94|ODO1_BACC2 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain G9842) GN=odhA PE=3 SV=1 138 930 8.0E-173
sp|B7HH19|ODO1_BACC4 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain B4264) GN=odhA PE=3 SV=1 138 930 1.0E-172
sp|Q5HPC6|ODO1_STAEQ 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=odhA PE=3 SV=1 138 924 2.0E-172
sp|B9IU58|ODO1_BACCQ 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain Q1) GN=odhA PE=3 SV=1 138 934 2.0E-172
sp|B7I0H2|ODO1_BACC7 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain AH187) GN=odhA PE=3 SV=1 138 934 2.0E-172
sp|Q2YY05|ODO1_STAAB 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=odhA PE=3 SV=1 138 924 4.0E-172
sp|C1ELG5|ODO1_BACC3 2-oxoglutarate dehydrogenase E1 component OS=Bacillus cereus (strain 03BB102) GN=odhA PE=3 SV=1 138 934 5.0E-172
sp|Q8CP83|ODO1_STAES 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus epidermidis (strain ATCC 12228) GN=odhA PE=3 SV=1 138 924 3.0E-171
sp|Q5WG56|ODO1_BACSK 2-oxoglutarate dehydrogenase E1 component OS=Bacillus clausii (strain KSM-K16) GN=odhA PE=3 SV=1 19 927 3.0E-170
sp|Q49XM5|ODO1_STAS1 2-oxoglutarate dehydrogenase E1 component OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=odhA PE=3 SV=1 138 926 2.0E-165
[Show less]

GO

GO Term Description Terminal node
GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2505
MARPRALGLMRRYSTDATHSAPDPSDNFLSGSTANYIDEMYMQWKRDPKSVHAFQPPPNLVPNMTGGVPRLGGGL
TLEDGSDVTNHLKVQLLPKELNLDHYGFTEKDMDTEYTLGPGILPRFKRDGRDKMTLREICDWLRERLEVPQPFR
YSIDEKRRILDRLIWSSNFESFLATKYPNDKRFGLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSN
VVRKPNESIFSEFAGTGGAEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNN
DEKTHRTAMSVLLHGDAAFAAQGIVYECIGFHSLPAFSTGGSVHLVVNNQIGFTTDPRFARSTAYCTDIAKAIDA
PVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLVCYRKHGHNETDQPSFTQPLMYKRINSKEPQIDVYVNKLL
QDGTFTKEDVDEHKQWVWGMLEESFNKSKEYQPTSKEWTTSAWNGFKSPKELATEILPHHATKVDVKTLEHVGEV
IGSAPEGFHIHRNLKRILANRTKSVVEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHSVFHDQET
EETYTPLQHISKDQGKFVIANSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQFIASGEVKWMQ
RTGLVMSLPHGYDGQGPEHSSGRIERYLQLCNEDPRIFPSPEKLPRQHQDCNMQIAYMTTPANMFHVLRRQMHRQ
FRKPLVIFFSKSLLRHPLARSDIEDFCGQDSGFQWIIPDPEHQTGNIKPPDEIDRVILCSGQVWASLHKYRADNK
IDNVAFTRLEQLNPFPWKQLQENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTKYHYRKHVMYAGRNP
SASVATGMKQVHTKEEHELLETAFTVKQDKLKGE*
Coding >OphauB2|2505
ATGGCGCGGCCTCGGGCCCTTGGCCTCATGCGCCGATACTCTACCGACGCGACGCACTCGGCCCCCGACCCCAGC
GACAACTTCCTGTCGGGCAGCACGGCAAACTACATTGACGAAATGTACATGCAATGGAAACGAGACCCCAAGAGC
GTCCACGCCTTCCAACCGCCTCCCAATCTGGTGCCCAACATGACGGGCGGCGTGCCTCGTCTAGGCGGCGGCTTG
ACTCTGGAAGATGGGTCCGATGTGACGAACCATCTCAAAGTGCAGCTCCTGCCCAAGGAGCTCAATCTCGACCAC
TATGGATTCACGGAAAAGGACATGGACACGGAGTATACCCTTGGCCCTGGCATCTTGCCCCGGTTTAAGCGCGAC
GGCCGCGACAAGATGACGCTTCGCGAAATCTGCGACTGGCTACGCGAGCGCCTCGAGGTGCCTCAGCCCTTTCGC
TACTCGATTGATGAGAAGCGCCGCATTCTTGATCGACTCATTTGGAGCTCCAACTTCGAGTCGTTTCTGGCGACA
AAATACCCCAATGACAAGCGCTTTGGCCTCGAGGGCTGCGAGACGCTGGTGCCTGGCATGAAGGCCTTGATAGAC
CGAAGCGTCGACTATGGCGTCAAGGACATTGTCATTGGCATGCCGCATCGCGGGCGTCTCAATGTGCTGAGCAAC
GTGGTGCGCAAGCCCAACGAGTCCATCTTCTCCGAGTTTGCTGGGACTGGCGGCGCCGAAGACGAAGGTTCAGGC
GACGTCAAGTATCACCTGGGCATGAACTTTGAGCGTCCCACGCCGTCGGGCAAGCGCGTGCAGCTTTCCCTTGTG
GCCAATCCGTCGCATCTCGAGGCCGAGGACCCGGTTGTGCTGGGCAAGACGCGAGCCATTCAGCACTACAATAAT
GACGAGAAGACGCACCGCACCGCCATGAGCGTCTTGCTGCATGGCGATGCCGCCTTTGCCGCCCAAGGAATTGTG
TACGAGTGCATTGGCTTCCATTCCCTGCCCGCCTTTTCCACGGGAGGCTCGGTCCACCTTGTAGTCAACAACCAG
ATTGGATTCACGACTGATCCCCGCTTTGCCCGCTCAACGGCCTACTGCACCGACATTGCCAAGGCGATTGACGCG
CCCGTCTTCCACGTCAATGCCGACGATGTGGAGGCGGTCAACTTTGTCTGCCAGCTTGCGGCCGACTGGCGTGCT
GAATTCCAGCACGACGTGGTGATTGATCTGGTTTGCTACCGCAAGCATGGGCACAACGAGACGGACCAACCCTCG
TTTACGCAGCCTCTCATGTACAAGCGCATCAACTCCAAGGAGCCCCAGATCGACGTCTATGTCAACAAGCTGCTG
CAAGACGGCACCTTTACCAAGGAGGACGTGGACGAGCACAAGCAGTGGGTGTGGGGCATGCTCGAGGAGAGCTTC
AACAAGTCCAAAGAGTACCAGCCCACGTCCAAGGAATGGACCACGTCGGCGTGGAACGGCTTCAAGTCTCCCAAG
GAGCTTGCCACGGAGATTTTGCCCCACCACGCCACCAAGGTGGACGTCAAGACTCTGGAGCATGTTGGCGAGGTG
ATTGGCTCGGCGCCCGAGGGCTTCCACATCCACCGCAACTTGAAGCGCATCCTGGCCAACCGCACCAAGTCTGTT
GTCGAGGGCAAGAACATTGACTTTCCCACGGCCGAGGCGCTGGCCTTTGGCTCTCTGGTGACTGAGGGATACCAC
GTGCGCGTGTCGGGCCAAGACGTGGAGCGCGGCACCTTTTCGCAGCGGCACTCCGTCTTCCACGACCAAGAGACG
GAGGAGACGTATACGCCGCTGCAGCACATCAGCAAGGACCAGGGCAAGTTTGTCATTGCCAACTCGTCGCTCAGT
GAGTTTGGCGCGCTTGGGTTTGAGTACGGCTACTCGCTGTCGTCGCCCAACGCCCTAGTCATGTGGGAGGCTCAG
TTTGGCGACTTTGCCAATAATGCCCAGTGCATCATTGACCAGTTTATTGCCTCTGGCGAGGTCAAGTGGATGCAG
CGCACCGGCCTCGTCATGTCCCTGCCCCACGGCTACGATGGCCAGGGCCCGGAGCACTCGTCTGGTCGCATTGAA
CGCTATCTGCAGCTTTGCAACGAGGACCCGCGCATCTTTCCATCCCCCGAAAAGCTTCCCCGCCAGCACCAGGAC
TGCAACATGCAGATTGCCTACATGACGACGCCGGCCAACATGTTTCACGTGCTGCGTCGCCAGATGCACCGTCAG
TTTCGCAAGCCGCTCGTCATCTTCTTCTCAAAATCGCTGCTTCGCCACCCCTTGGCGCGATCCGACATTGAAGAC
TTTTGCGGCCAAGACTCGGGCTTCCAATGGATCATTCCGGATCCCGAGCACCAAACAGGCAACATCAAGCCCCCC
GACGAGATTGACCGCGTCATTCTCTGCTCGGGCCAGGTTTGGGCCAGCCTTCACAAGTACCGCGCCGACAACAAG
ATTGACAATGTCGCCTTTACGCGCCTGGAGCAGCTCAACCCGTTTCCGTGGAAGCAGCTTCAGGAGAATCTGGAC
ATGTACCCCAATGCCAAGACGATTGTCTGGGCGCAGGAAGAGCCGCTCAATGCAGGCGCATGGAGCTTCACACAG
CCACGCATCGAGACGCTGCTCAACCAAACCAAGTATCACTACCGAAAACACGTCATGTATGCTGGTCGCAACCCT
AGCGCATCGGTGGCGACGGGTATGAAGCAGGTTCACACCAAGGAGGAGCACGAACTGCTCGAGACCGCCTTTACC
GTCAAGCAGGACAAGCTCAAGGGCGAGTGA
Transcript >OphauB2|2505
ATGGCGCGGCCTCGGGCCCTTGGCCTCATGCGCCGATACTCTACCGACGCGACGCACTCGGCCCCCGACCCCAGC
GACAACTTCCTGTCGGGCAGCACGGCAAACTACATTGACGAAATGTACATGCAATGGAAACGAGACCCCAAGAGC
GTCCACGCCTTCCAACCGCCTCCCAATCTGGTGCCCAACATGACGGGCGGCGTGCCTCGTCTAGGCGGCGGCTTG
ACTCTGGAAGATGGGTCCGATGTGACGAACCATCTCAAAGTGCAGCTCCTGCCCAAGGAGCTCAATCTCGACCAC
TATGGATTCACGGAAAAGGACATGGACACGGAGTATACCCTTGGCCCTGGCATCTTGCCCCGGTTTAAGCGCGAC
GGCCGCGACAAGATGACGCTTCGCGAAATCTGCGACTGGCTACGCGAGCGCCTCGAGGTGCCTCAGCCCTTTCGC
TACTCGATTGATGAGAAGCGCCGCATTCTTGATCGACTCATTTGGAGCTCCAACTTCGAGTCGTTTCTGGCGACA
AAATACCCCAATGACAAGCGCTTTGGCCTCGAGGGCTGCGAGACGCTGGTGCCTGGCATGAAGGCCTTGATAGAC
CGAAGCGTCGACTATGGCGTCAAGGACATTGTCATTGGCATGCCGCATCGCGGGCGTCTCAATGTGCTGAGCAAC
GTGGTGCGCAAGCCCAACGAGTCCATCTTCTCCGAGTTTGCTGGGACTGGCGGCGCCGAAGACGAAGGTTCAGGC
GACGTCAAGTATCACCTGGGCATGAACTTTGAGCGTCCCACGCCGTCGGGCAAGCGCGTGCAGCTTTCCCTTGTG
GCCAATCCGTCGCATCTCGAGGCCGAGGACCCGGTTGTGCTGGGCAAGACGCGAGCCATTCAGCACTACAATAAT
GACGAGAAGACGCACCGCACCGCCATGAGCGTCTTGCTGCATGGCGATGCCGCCTTTGCCGCCCAAGGAATTGTG
TACGAGTGCATTGGCTTCCATTCCCTGCCCGCCTTTTCCACGGGAGGCTCGGTCCACCTTGTAGTCAACAACCAG
ATTGGATTCACGACTGATCCCCGCTTTGCCCGCTCAACGGCCTACTGCACCGACATTGCCAAGGCGATTGACGCG
CCCGTCTTCCACGTCAATGCCGACGATGTGGAGGCGGTCAACTTTGTCTGCCAGCTTGCGGCCGACTGGCGTGCT
GAATTCCAGCACGACGTGGTGATTGATCTGGTTTGCTACCGCAAGCATGGGCACAACGAGACGGACCAACCCTCG
TTTACGCAGCCTCTCATGTACAAGCGCATCAACTCCAAGGAGCCCCAGATCGACGTCTATGTCAACAAGCTGCTG
CAAGACGGCACCTTTACCAAGGAGGACGTGGACGAGCACAAGCAGTGGGTGTGGGGCATGCTCGAGGAGAGCTTC
AACAAGTCCAAAGAGTACCAGCCCACGTCCAAGGAATGGACCACGTCGGCGTGGAACGGCTTCAAGTCTCCCAAG
GAGCTTGCCACGGAGATTTTGCCCCACCACGCCACCAAGGTGGACGTCAAGACTCTGGAGCATGTTGGCGAGGTG
ATTGGCTCGGCGCCCGAGGGCTTCCACATCCACCGCAACTTGAAGCGCATCCTGGCCAACCGCACCAAGTCTGTT
GTCGAGGGCAAGAACATTGACTTTCCCACGGCCGAGGCGCTGGCCTTTGGCTCTCTGGTGACTGAGGGATACCAC
GTGCGCGTGTCGGGCCAAGACGTGGAGCGCGGCACCTTTTCGCAGCGGCACTCCGTCTTCCACGACCAAGAGACG
GAGGAGACGTATACGCCGCTGCAGCACATCAGCAAGGACCAGGGCAAGTTTGTCATTGCCAACTCGTCGCTCAGT
GAGTTTGGCGCGCTTGGGTTTGAGTACGGCTACTCGCTGTCGTCGCCCAACGCCCTAGTCATGTGGGAGGCTCAG
TTTGGCGACTTTGCCAATAATGCCCAGTGCATCATTGACCAGTTTATTGCCTCTGGCGAGGTCAAGTGGATGCAG
CGCACCGGCCTCGTCATGTCCCTGCCCCACGGCTACGATGGCCAGGGCCCGGAGCACTCGTCTGGTCGCATTGAA
CGCTATCTGCAGCTTTGCAACGAGGACCCGCGCATCTTTCCATCCCCCGAAAAGCTTCCCCGCCAGCACCAGGAC
TGCAACATGCAGATTGCCTACATGACGACGCCGGCCAACATGTTTCACGTGCTGCGTCGCCAGATGCACCGTCAG
TTTCGCAAGCCGCTCGTCATCTTCTTCTCAAAATCGCTGCTTCGCCACCCCTTGGCGCGATCCGACATTGAAGAC
TTTTGCGGCCAAGACTCGGGCTTCCAATGGATCATTCCGGATCCCGAGCACCAAACAGGCAACATCAAGCCCCCC
GACGAGATTGACCGCGTCATTCTCTGCTCGGGCCAGGTTTGGGCCAGCCTTCACAAGTACCGCGCCGACAACAAG
ATTGACAATGTCGCCTTTACGCGCCTGGAGCAGCTCAACCCGTTTCCGTGGAAGCAGCTTCAGGAGAATCTGGAC
ATGTACCCCAATGCCAAGACGATTGTCTGGGCGCAGGAAGAGCCGCTCAATGCAGGCGCATGGAGCTTCACACAG
CCACGCATCGAGACGCTGCTCAACCAAACCAAGTATCACTACCGAAAACACGTCATGTATGCTGGTCGCAACCCT
AGCGCATCGGTGGCGACGGGTATGAAGCAGGTTCACACCAAGGAGGAGCACGAACTGCTCGAGACCGCCTTTACC
GTCAAGCAGGACAAGCTCAAGGGCGAGTGA
Gene >OphauB2|2505
ATGGCGCGGCCTCGGGCCCTTGGCCTCATGCGCCGATACTCTACCGACGCGACGCACTCGGCCCCCGACCCCAGC
GACAACTTCCTGTCGGGCAGCACGGCAAACTACATTGACGAAATGTACATGCAATGGAAACGAGACCCCAAGAGC
GTCCACGTGTCGTGGCAGGTCTACTTCAAAAACATGGAGAGCGGCGACATGCCCATCTCGCAGGCCTTCCAACCG
CCTCCCAATCTGGTGCCCAACATGACGGGCGGCGTGCCTCGTCTAGGCGGCGGCTTGACTCTGGAAGATGGGTCC
GATGTGACGAACCATCTCAAAGTGCAGCTCCTGGTGCGTGCCTACCAGGCCCGCGGCCACCACAAGGCAAACATT
GACCCTCTGGGTATCCGAAACACGGCTACCGGATTCGGCAATGTGAAGCCCAAGGAGCTCAATCTCGACCACTAT
GGATTCACGGAAAAGGACATGGACACGGAGTATACCCTTGGCCCTGGCATCTTGCCCCGGTTTAAGCGCGACGGC
CGCGACAAGATGACGCTTCGCGAAATCGTGGCGGCGTGCGAAAAGATATATTGCGGGTCGTTTGGAGTCGAGTTT
ATCCATATTCCCGATCGCGAAAAGTGCGACTGGCTACGCGAGCGCCTCGAGGTGCCTCAGCCCTTTCGCTACTCG
ATTGATGAGAAGCGCCGCATTCTTGATCGACTCATTTGGAGCTCCAACTTCGAGTCGTTTCTGGCGACAAAATAC
CCCAATGACAAGCGCTTTGGCCTCGAGGGCTGCGAGACGCTGGTGCCTGGCATGAAGGCCTTGATAGACCGAAGC
GTCGACTATGGCGTCAAGGACATTGTCATTGGCATGCCGCATCGCGGGCGTCTCAATGTGCTGAGCAACGTGGTG
CGCAAGCCCAACGAGTCCATCTTCTCCGAGTTTGCTGGGACTGGCGGCGCCGAAGACGAAGGTTCAGGCGACGTC
AAGTATCACCTGGGCATGAACTTTGAGCGTCCCACGCCGTCGGGCAAGCGCGTGCAGCTTTCCCTTGTGGCCAAT
CCGTCGCATCTCGAGGCCGAGGACCCGGTTGTGCTGGGCAAGACGCGAGCCATTCAGCACTACAATAATGACGAG
AAGACGCACCGCACCGCCATGAGCGTCTTGCTGCATGGCGATGCCGCCTTTGCCGCCCAAGGAATTGTGTACGAG
TGCATTGGCTTCCATTCCCTGCCCGCCTTTTCCACGGGAGGCTCGGTCCACCTTGTAGTCAACAACCAGATTGGA
TTCACGACTGATCCCCGCTTTGCCCGCTCAACGGCCTACTGCACCGACATTGCCAAGGCGATTGACGCGCCCGTC
TTCCACGTCAATGCCGACGATGTGGAGGCGGTCAACTTTGTCTGCCAGCTTGCGGCCGACTGGCGTGCTGAATTC
CAGCACGACGTGGTGATTGATCTGGTTTGCTACCGCAAGCATGGGCACAACGAGACGGACCAACCCTCGTTTACG
CAGCCTCTCATGTACAAGCGCATCAACTCCAAGGAGCCCCAGATCGACGTCTATGTCAACAAGCTGCTGCAAGAC
GGCACCTTTACCAAGGAGGACGTGGACGAGCACAAGCAGTGGGTGTGGGGCATGCTCGAGGAGAGCTTCAACAAG
TCCAAAGAGTACCAGCCCACGTCCAAGGAATGGACCACGTCGGCGTGGAACGGCTTCAAGTCTCCCAAGGAGCTT
GCCACGGAGATTTTGCCCCACCACGCCACCAAGGTGGACGTCAAGACTCTGGAGCATGTTGGCGAGGTGATTGGC
TCGGCGCCCGAGGGCTTCCACATCCACCGCAACTTGAAGCGCATCCTGGCCAACCGCACCAAGTCTGTTGTCGAG
GGCAAGAACATTGACTTTCCCACGGCCGAGGCGCTGGCCTTTGGCTCTCTGGTGACTGAGGGATACCACGTGCGC
GTGTCGGGCCAAGACGTGGAGCGCGGCACCTTTTCGCAGCGGCACTCCGTCTTCCACGACCAAGAGACGGAGGAG
ACGTATACGCCGCTGCAGCACATCAGCAAGGACCAGGGCAAGTTTGTCATTGCCAACTCGTCGCTCAGTGAGTTT
GGCGCGCTTGGGTTTGAGTACGGCTACTCGCTGTCGTCGCCCAACGCCCTAGTCATGTGGGAGGCTCAGTTTGGC
GACTTTGCCAATAATGCCCAGTGCATCATTGACCAGTTTATTGCCTCTGGCGAGGTCAAGTGGATGCAGCGCACC
GGCCTCGTCATGTCCCTGCCCCACGGCTACGATGGCCAGGGCCCGGAGCACTCGTCTGGTCGCATTGAACGCTAT
CTGCAGCTTTGCAACGAGGACCCGCGCATCTTTCCATCCCCCGAAAAGCTTCCCCGCCAGCACCAGGACTGCAAC
ATGCAGATTGCCTACATGACGACGCCGGCCAACATGTTTCACGTGCTGCGTCGCCAGATGCACCGTCAGTTTCGC
AAGCGTAAGATTTGTCCCCCTTGATTTTTTTTTTTGTTTGCTGTCAACTAACAGTAATGCTGCAGCGCTCGTCAT
CTTCTTCTCAAAATCGCTGCTTCGCCACCCCTTGGCGCGATCCGACATTGAAGACTTTTGCGGCCAAGACTCGGG
CTTCCAATGGATCATTCCGGATCCCGAGCACCAAACAGGCAACATCAAGCCCCCCGACGAGATTGACCGCGTCAT
TCTCTGCTCGGGCCAGGTTTGGGCCAGCCTTCACAAGTACCGCGCCGACAACAAGATTGACAATGTCGCCTTTAC
GCGCCTGGAGCAGCTCAACCCGTTTCCGTGGAAGCAGCTTCAGGAGAATCTGGACATGTACCCCAATGCCAAGAC
GATTGTCTGGGCGCAGGAAGAGCCGCTCAATGCAGGCGCATGGAGCTTCACACAGCCACGCATCGAGACGCTGCT
CAACCAAACCAAGTATCACTACCGAAAACACGTCATGTATGCTGGTCGCAACCCTAGCGCATCGGTGGCGACGGG
TATGAAGCAGGTTCACACCAAGGAGGAGCACGAACTGCTCGAGACCGCCTTTACCGTCAAGCAGGACAAGCTCAA
GGGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail