Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2499
Gene name
LocationContig_18:88843..92321
Strand+
Gene length (bp)3478
Transcript length (bp)3099
Coding sequence length (bp)3099
Protein length (aa) 1033

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 4.7E-34 739 970
PF04072 LCM Leucine carboxyl methyltransferase 5.4E-19 13 210
PF08007 JmjC_2 JmjC domain 3.1E-06 870 965

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U6D4|TYW4_ASPOR tRNA wybutosine-synthesizing protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ppm2 PE=3 SV=2 14 1028 0.0E+00
sp|Q4IER0|TYW4_GIBZE tRNA wybutosine-synthesizing protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPM2 PE=3 SV=1 9 1023 0.0E+00
sp|Q9P3K9|TYW4_NEUCR tRNA wybutosine-synthesizing protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lcm-2 PE=3 SV=1 152 1028 0.0E+00
sp|Q4WVD1|TYW4_ASPFU tRNA wybutosine-synthesizing protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppm2 PE=3 SV=2 14 1027 0.0E+00
sp|Q5BH52|TYW4_EMENI tRNA wybutosine-synthesizing protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppm2 PE=3 SV=3 14 1028 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U6D4|TYW4_ASPOR tRNA wybutosine-synthesizing protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ppm2 PE=3 SV=2 14 1028 0.0E+00
sp|Q4IER0|TYW4_GIBZE tRNA wybutosine-synthesizing protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPM2 PE=3 SV=1 9 1023 0.0E+00
sp|Q9P3K9|TYW4_NEUCR tRNA wybutosine-synthesizing protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lcm-2 PE=3 SV=1 152 1028 0.0E+00
sp|Q4WVD1|TYW4_ASPFU tRNA wybutosine-synthesizing protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppm2 PE=3 SV=2 14 1027 0.0E+00
sp|Q5BH52|TYW4_EMENI tRNA wybutosine-synthesizing protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppm2 PE=3 SV=3 14 1028 0.0E+00
sp|Q6C3P4|TYW4_YARLI tRNA wybutosine-synthesizing protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPM2 PE=3 SV=1 11 1025 4.0E-142
sp|Q75AW4|TYW4_ASHGO tRNA wybutosine-synthesizing protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPM2 PE=3 SV=1 13 671 1.0E-68
sp|Q5A931|TYW4_CANAL tRNA wybutosine-synthesizing protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPM2 PE=3 SV=1 13 675 2.0E-66
sp|Q08282|TYW4_YEAST tRNA wybutosine-synthesizing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPM2 PE=1 SV=2 4 675 3.0E-66
sp|Q6FXA5|TYW4_CANGA tRNA wybutosine-synthesizing protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPM2 PE=3 SV=1 13 679 2.0E-64
sp|O60157|TYW4_SCHPO tRNA wybutosine-synthesizing protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppm2 PE=3 SV=1 1 669 9.0E-53
sp|A2RUC4|TYW5_HUMAN tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens GN=TYW5 PE=1 SV=1 730 1027 4.0E-45
sp|A2RSX7|TYW5_MOUSE tRNA wybutosine-synthesizing protein 5 OS=Mus musculus GN=Tyw5 PE=2 SV=2 730 1027 4.0E-45
sp|Q9P3K9|TYW4_NEUCR tRNA wybutosine-synthesizing protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lcm-2 PE=3 SV=1 8 151 7.0E-42
sp|Q8BYR1|TYW4_MOUSE tRNA wybutosine-synthesizing protein 4 OS=Mus musculus GN=Lcmt2 PE=2 SV=4 16 671 1.0E-41
sp|E1C7T6|TYW5_CHICK tRNA wybutosine-synthesizing protein 5 OS=Gallus gallus GN=TYW5 PE=3 SV=1 750 1027 2.0E-41
sp|Q08BV2|TYW5_DANRE tRNA wybutosine-synthesizing protein 5 OS=Danio rerio GN=tyw5 PE=2 SV=1 745 1027 6.0E-38
sp|O60294|TYW4_HUMAN tRNA wybutosine-synthesizing protein 4 OS=Homo sapiens GN=LCMT2 PE=1 SV=3 16 512 4.0E-35
sp|Q5XIA3|TYW4_RAT tRNA wybutosine-synthesizing protein 4 OS=Rattus norvegicus GN=Lcmt2 PE=2 SV=1 16 672 5.0E-35
sp|Q9UIC8|LCMT1_HUMAN Leucine carboxyl methyltransferase 1 OS=Homo sapiens GN=LCMT1 PE=1 SV=2 11 321 2.0E-25
sp|Q4ICG8|LCMT1_GIBZE Leucine carboxyl methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPM1 PE=3 SV=1 13 321 3.0E-25
sp|Q3T0H0|LCMT1_BOVIN Leucine carboxyl methyltransferase 1 OS=Bos taurus GN=LCMT1 PE=2 SV=1 8 321 3.0E-24
sp|Q6P4Z6|LCMT1_RAT Leucine carboxyl methyltransferase 1 OS=Rattus norvegicus GN=Lcmt1 PE=2 SV=1 13 321 1.0E-23
sp|Q4WS57|LCMT1_ASPFU Leucine carboxyl methyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppm1 PE=3 SV=1 11 317 1.0E-23
sp|Q5AQJ2|LCMT1_EMENI Leucine carboxyl methyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppm1 PE=3 SV=2 13 317 8.0E-22
sp|P46554|LCMT1_CAEEL Probable leucine carboxyl methyltransferase 1 OS=Caenorhabditis elegans GN=B0285.4 PE=3 SV=1 53 322 5.0E-21
sp|Q7SAP7|LCMT1_NEUCR Leucine carboxyl methyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppm-1 PE=3 SV=2 9 318 1.0E-19
sp|Q60YU0|LCMT1_CAEBR Probable leucine carboxyl methyltransferase 1 OS=Caenorhabditis briggsae GN=CBG18087 PE=3 SV=1 47 320 8.0E-19
sp|Q6C997|LCMT1_YARLI Leucine carboxyl methyltransferase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPM1 PE=3 SV=1 13 321 1.0E-18
sp|O94257|LCMT1_SCHPO Leucine carboxyl methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppm1 PE=3 SV=1 42 321 8.0E-15
sp|P0CO56|LCMT1_CRYNJ Leucine carboxyl methyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPM1 PE=3 SV=1 33 317 1.0E-13
sp|Q5A387|LCMT1_CANAL Leucine carboxyl methyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPM1 PE=3 SV=1 52 321 1.0E-13
sp|P0CO57|LCMT1_CRYNB Leucine carboxyl methyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PPM1 PE=3 SV=1 33 317 1.0E-13
sp|Q4P4G2|LCMT1_USTMA Leucine carboxyl methyltransferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PPM1 PE=3 SV=2 13 320 4.0E-12
sp|Q8BLR9|HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus GN=Hif1an PE=1 SV=2 730 968 4.0E-08
sp|Q04081|LCMT1_YEAST Leucine carboxyl methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPM1 PE=1 SV=1 44 320 1.0E-07
sp|Q9NWT6|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens GN=HIF1AN PE=1 SV=2 730 968 1.0E-07
sp|Q6FUI5|LCMT1_CANGA Leucine carboxyl methyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPM1 PE=3 SV=1 56 317 2.0E-07
sp|Q6BQD2|LCMT1_DEBHA Leucine carboxyl methyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPM1 PE=3 SV=2 52 327 1.0E-06
sp|Q759U5|LCMT1_ASHGO Leucine carboxyl methyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPM1 PE=3 SV=2 56 321 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0032259 methylation Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2499
MAQQQQPPSQALDDLIMGTNSSSIVSKRSVERLYHSKEPQFFRYFVANNKFQRRSPLINRGYWLRLRAIDRLVGR
FLSRPSSKPKVVVNLGCGSDALPWQCHARYPSACNGALFVDIDYPQLMLKKRHVVLQTPQLEALTRNGLCIDFTP
LVLLKSQLYCQLGCDLRQLHHLDQSLASVLPSPDCEILFVAEVSLTYMDTLSANALLKWASCVCSDVEFCLLEQI
LPQGPNHAFAKTMLAHFDKLKTPPKSVHRYQTLDCQRARFQSHGWRAAQSWDLWDLWSSNDFVSPTERIALDMVE
PFDEWEEFMLFARHYCLIHASMPTSASCPRPADTTEKPTCNQDDFQVRRLLDNAPKRRFGDCLMAPNTLGAQYLI
HMMGTGTSGRCDSYHIYSLNADLHMDPPKLPLSGPTPRVAFSMTTLGDFGVLLVGGRSSPSSPLSDCWIFLKESQ
CRWQATWKLPIPLFRHSAVRLARSSLVLVMGGKTGPSSISDASFVFDPQRGWLKCRLEGSAPRPTFGALAMCMPC
LSSKIPGLFQGLYAGGIGQDGRVATEKYAWRLHFMAKSEPTIQFELLNASFGANTSSDCLELFGAKCVDLGSQVM
ICGGMGQNASFQGYDLIQVTTTEDESYSIQKLGRKDASSMPFIIGSSLIASDRGFLIIGGGATCFSMGTFWESGF
YHVELHQPSNCWRDVSSATSSRLISEVELVETRKVVVSNSSIGQDVLSTKATMAPIPRIQLGPDKTFDQVASEGK
PVVIQGLDIGSCLDKWTSSYMVERVGKATEVVVHWCQKDDEKMDFNSKNFDYISDSFENVMAKMEAGARMYLRCL
SRDKPTEQPADLEKDFPQLSPDLCLPPELSMVKDRLFSSILRVSGRVTMWLHYDVMANVYMQIRGERRMMLFPPS
DVRHLSLAPGASSSSVNVFDHVETLGLAATHPHHALLKPGDVLFLPSLWLHSGQAVSDMSVAVNVFFKHLDGDCY
AAGRDVYGNKDLAAYERGRLDVARIAKAFRHLPLETRDFYMSRLAQELEQAAQDGLA*
Coding >OphauB2|2499
ATGGCGCAGCAGCAACAGCCGCCATCGCAGGCGCTTGACGACTTGATCATGGGGACAAATAGCAGCAGCATCGTC
TCAAAGCGCAGCGTCGAGCGCCTATACCATTCCAAGGAGCCTCAGTTCTTTCGCTACTTCGTCGCCAATAACAAA
TTCCAACGCCGGTCGCCTCTGATCAATCGCGGTTACTGGCTGAGGCTTAGGGCAATTGATCGTCTTGTTGGTCGC
TTTCTCTCCCGTCCTTCGTCAAAACCCAAGGTTGTGGTGAATCTTGGTTGTGGCAGCGATGCACTGCCATGGCAA
TGCCATGCTCGCTATCCATCTGCATGCAATGGGGCTCTCTTTGTCGACATTGACTACCCCCAGCTCATGCTTAAG
AAACGTCATGTCGTATTACAAACACCCCAGCTAGAGGCTCTGACGAGAAACGGACTGTGCATCGACTTCACGCCC
CTAGTATTACTCAAAAGCCAGTTATACTGCCAGCTTGGCTGTGACCTTCGCCAGCTCCATCATCTTGACCAGTCT
CTGGCTTCCGTCCTGCCATCGCCCGATTGCGAGATACTGTTCGTGGCCGAAGTTTCTTTAACGTACATGGATACG
TTGTCTGCAAATGCCCTATTAAAGTGGGCCAGCTGTGTTTGTAGTGATGTCGAGTTTTGTTTATTGGAACAGATT
CTTCCTCAAGGCCCCAATCACGCTTTTGCAAAAACAATGCTCGCCCATTTTGACAAGCTGAAAACGCCGCCTAAA
TCAGTTCACCGCTACCAAACACTTGATTGTCAGCGAGCTCGTTTCCAGAGTCATGGATGGAGAGCGGCACAAAGT
TGGGACTTGTGGGATCTGTGGTCAAGCAACGACTTTGTCAGTCCGACTGAGAGAATTGCATTGGACATGGTAGAG
CCTTTTGACGAGTGGGAGGAGTTTATGCTCTTCGCACGTCACTACTGCCTTATTCACGCTTCCATGCCCACCTCC
GCAAGCTGTCCCCGACCAGCCGACACGACGGAGAAGCCGACATGTAATCAAGACGATTTCCAAGTACGTCGTCTC
TTGGATAATGCCCCGAAACGACGCTTCGGCGATTGCTTGATGGCTCCAAATACTCTTGGTGCCCAATATCTCATT
CACATGATGGGGACAGGTACTAGCGGCAGGTGTGACAGCTATCACATATACTCGCTTAATGCAGATCTTCACATG
GACCCTCCCAAGCTGCCCTTGTCGGGACCAACCCCTCGCGTCGCATTCAGCATGACAACGCTGGGCGATTTCGGA
GTACTGCTTGTGGGCGGACGGAGCTCACCGTCAAGTCCATTATCGGACTGTTGGATCTTTCTCAAAGAATCCCAG
TGCCGCTGGCAAGCTACGTGGAAATTGCCCATTCCACTATTCAGACACTCAGCCGTCCGCCTCGCACGCTCATCT
TTGGTTCTTGTTATGGGAGGCAAAACAGGCCCTTCATCAATATCAGATGCCTCCTTCGTCTTTGATCCTCAAAGA
GGCTGGTTAAAATGTCGACTTGAGGGTTCTGCTCCCCGTCCAACCTTTGGGGCACTTGCTATGTGCATGCCATGC
CTATCCAGTAAAATTCCGGGCCTTTTTCAAGGCTTGTATGCCGGCGGTATTGGCCAAGACGGTCGGGTTGCAACG
GAGAAGTATGCCTGGCGTCTCCACTTCATGGCAAAGTCCGAGCCGACTATTCAATTCGAGCTACTCAATGCCAGC
TTTGGAGCCAACACCAGCAGTGATTGCCTGGAGCTTTTTGGTGCCAAATGCGTCGACTTGGGCTCGCAGGTGATG
ATATGCGGCGGCATGGGCCAGAATGCCTCATTTCAAGGCTACGACTTGATCCAGGTCACCACGACAGAAGATGAA
TCGTACTCGATACAAAAACTCGGGCGAAAAGATGCTTCTTCAATGCCCTTTATAATTGGATCGTCACTAATTGCC
TCGGATAGGGGGTTCCTTATTATCGGTGGTGGGGCAACTTGCTTCTCCATGGGAACATTTTGGGAATCAGGCTTT
TACCATGTTGAGCTACATCAACCCAGTAATTGTTGGCGCGATGTAAGTTCTGCTACGAGTAGTAGGCTTATATCG
GAGGTTGAATTAGTAGAGACACGCAAAGTCGTTGTGAGTAATTCCAGCATTGGCCAAGACGTGCTGAGTACGAAG
GCGACGATGGCACCGATACCCAGAATTCAACTCGGACCCGACAAAACTTTTGATCAAGTCGCTAGCGAAGGCAAA
CCCGTAGTCATTCAAGGTCTTGATATCGGGAGTTGCTTGGATAAGTGGACTTCTAGCTATATGGTGGAGCGGGTG
GGCAAAGCAACAGAGGTTGTTGTCCATTGGTGCCAAAAAGATGACGAGAAGATGGACTTTAACTCGAAAAACTTT
GACTATATCAGCGATAGTTTTGAGAATGTCATGGCAAAGATGGAGGCCGGTGCTAGAATGTATCTGAGGTGCTTG
TCTCGAGATAAGCCAACGGAGCAGCCCGCAGACCTGGAAAAGGATTTCCCCCAACTCTCGCCAGACCTTTGTCTG
CCCCCAGAATTGAGCATGGTCAAGGATCGGCTGTTTAGCTCAATACTGAGAGTGTCGGGCAGAGTCACCATGTGG
CTGCACTACGATGTCATGGCCAATGTGTATATGCAAATCAGGGGCGAGAGGCGCATGATGCTCTTCCCGCCGAGC
GATGTGCGCCACCTATCCTTGGCACCCGGTGCCTCGAGCTCAAGCGTAAACGTCTTTGACCATGTCGAGACTCTC
GGCCTGGCAGCCACGCATCCGCACCACGCACTGCTCAAGCCAGGCGACGTGCTCTTCTTGCCTTCGCTGTGGCTC
CATTCAGGACAAGCCGTGTCGGATATGAGCGTGGCGGTCAATGTGTTTTTTAAACATCTCGACGGAGACTGCTAT
GCGGCTGGCCGCGACGTTTACGGTAATAAAGACTTGGCGGCCTATGAGAGAGGGCGGCTCGACGTGGCTCGCATA
GCAAAGGCTTTTCGACACTTGCCCTTGGAAACAAGAGACTTTTACATGTCTCGCCTCGCGCAAGAGCTGGAGCAG
GCAGCACAAGATGGGCTGGCTTGA
Transcript >OphauB2|2499
ATGGCGCAGCAGCAACAGCCGCCATCGCAGGCGCTTGACGACTTGATCATGGGGACAAATAGCAGCAGCATCGTC
TCAAAGCGCAGCGTCGAGCGCCTATACCATTCCAAGGAGCCTCAGTTCTTTCGCTACTTCGTCGCCAATAACAAA
TTCCAACGCCGGTCGCCTCTGATCAATCGCGGTTACTGGCTGAGGCTTAGGGCAATTGATCGTCTTGTTGGTCGC
TTTCTCTCCCGTCCTTCGTCAAAACCCAAGGTTGTGGTGAATCTTGGTTGTGGCAGCGATGCACTGCCATGGCAA
TGCCATGCTCGCTATCCATCTGCATGCAATGGGGCTCTCTTTGTCGACATTGACTACCCCCAGCTCATGCTTAAG
AAACGTCATGTCGTATTACAAACACCCCAGCTAGAGGCTCTGACGAGAAACGGACTGTGCATCGACTTCACGCCC
CTAGTATTACTCAAAAGCCAGTTATACTGCCAGCTTGGCTGTGACCTTCGCCAGCTCCATCATCTTGACCAGTCT
CTGGCTTCCGTCCTGCCATCGCCCGATTGCGAGATACTGTTCGTGGCCGAAGTTTCTTTAACGTACATGGATACG
TTGTCTGCAAATGCCCTATTAAAGTGGGCCAGCTGTGTTTGTAGTGATGTCGAGTTTTGTTTATTGGAACAGATT
CTTCCTCAAGGCCCCAATCACGCTTTTGCAAAAACAATGCTCGCCCATTTTGACAAGCTGAAAACGCCGCCTAAA
TCAGTTCACCGCTACCAAACACTTGATTGTCAGCGAGCTCGTTTCCAGAGTCATGGATGGAGAGCGGCACAAAGT
TGGGACTTGTGGGATCTGTGGTCAAGCAACGACTTTGTCAGTCCGACTGAGAGAATTGCATTGGACATGGTAGAG
CCTTTTGACGAGTGGGAGGAGTTTATGCTCTTCGCACGTCACTACTGCCTTATTCACGCTTCCATGCCCACCTCC
GCAAGCTGTCCCCGACCAGCCGACACGACGGAGAAGCCGACATGTAATCAAGACGATTTCCAAGTACGTCGTCTC
TTGGATAATGCCCCGAAACGACGCTTCGGCGATTGCTTGATGGCTCCAAATACTCTTGGTGCCCAATATCTCATT
CACATGATGGGGACAGGTACTAGCGGCAGGTGTGACAGCTATCACATATACTCGCTTAATGCAGATCTTCACATG
GACCCTCCCAAGCTGCCCTTGTCGGGACCAACCCCTCGCGTCGCATTCAGCATGACAACGCTGGGCGATTTCGGA
GTACTGCTTGTGGGCGGACGGAGCTCACCGTCAAGTCCATTATCGGACTGTTGGATCTTTCTCAAAGAATCCCAG
TGCCGCTGGCAAGCTACGTGGAAATTGCCCATTCCACTATTCAGACACTCAGCCGTCCGCCTCGCACGCTCATCT
TTGGTTCTTGTTATGGGAGGCAAAACAGGCCCTTCATCAATATCAGATGCCTCCTTCGTCTTTGATCCTCAAAGA
GGCTGGTTAAAATGTCGACTTGAGGGTTCTGCTCCCCGTCCAACCTTTGGGGCACTTGCTATGTGCATGCCATGC
CTATCCAGTAAAATTCCGGGCCTTTTTCAAGGCTTGTATGCCGGCGGTATTGGCCAAGACGGTCGGGTTGCAACG
GAGAAGTATGCCTGGCGTCTCCACTTCATGGCAAAGTCCGAGCCGACTATTCAATTCGAGCTACTCAATGCCAGC
TTTGGAGCCAACACCAGCAGTGATTGCCTGGAGCTTTTTGGTGCCAAATGCGTCGACTTGGGCTCGCAGGTGATG
ATATGCGGCGGCATGGGCCAGAATGCCTCATTTCAAGGCTACGACTTGATCCAGGTCACCACGACAGAAGATGAA
TCGTACTCGATACAAAAACTCGGGCGAAAAGATGCTTCTTCAATGCCCTTTATAATTGGATCGTCACTAATTGCC
TCGGATAGGGGGTTCCTTATTATCGGTGGTGGGGCAACTTGCTTCTCCATGGGAACATTTTGGGAATCAGGCTTT
TACCATGTTGAGCTACATCAACCCAGTAATTGTTGGCGCGATGTAAGTTCTGCTACGAGTAGTAGGCTTATATCG
GAGGTTGAATTAGTAGAGACACGCAAAGTCGTTGTGAGTAATTCCAGCATTGGCCAAGACGTGCTGAGTACGAAG
GCGACGATGGCACCGATACCCAGAATTCAACTCGGACCCGACAAAACTTTTGATCAAGTCGCTAGCGAAGGCAAA
CCCGTAGTCATTCAAGGTCTTGATATCGGGAGTTGCTTGGATAAGTGGACTTCTAGCTATATGGTGGAGCGGGTG
GGCAAAGCAACAGAGGTTGTTGTCCATTGGTGCCAAAAAGATGACGAGAAGATGGACTTTAACTCGAAAAACTTT
GACTATATCAGCGATAGTTTTGAGAATGTCATGGCAAAGATGGAGGCCGGTGCTAGAATGTATCTGAGGTGCTTG
TCTCGAGATAAGCCAACGGAGCAGCCCGCAGACCTGGAAAAGGATTTCCCCCAACTCTCGCCAGACCTTTGTCTG
CCCCCAGAATTGAGCATGGTCAAGGATCGGCTGTTTAGCTCAATACTGAGAGTGTCGGGCAGAGTCACCATGTGG
CTGCACTACGATGTCATGGCCAATGTGTATATGCAAATCAGGGGCGAGAGGCGCATGATGCTCTTCCCGCCGAGC
GATGTGCGCCACCTATCCTTGGCACCCGGTGCCTCGAGCTCAAGCGTAAACGTCTTTGACCATGTCGAGACTCTC
GGCCTGGCAGCCACGCATCCGCACCACGCACTGCTCAAGCCAGGCGACGTGCTCTTCTTGCCTTCGCTGTGGCTC
CATTCAGGACAAGCCGTGTCGGATATGAGCGTGGCGGTCAATGTGTTTTTTAAACATCTCGACGGAGACTGCTAT
GCGGCTGGCCGCGACGTTTACGGTAATAAAGACTTGGCGGCCTATGAGAGAGGGCGGCTCGACGTGGCTCGCATA
GCAAAGGCTTTTCGACACTTGCCCTTGGAAACAAGAGACTTTTACATGTCTCGCCTCGCGCAAGAGCTGGAGCAG
GCAGCACAAGATGGGCTGGCTTGA
Gene >OphauB2|2499
ATGGCGCAGCAGCAACAGCCGCCATCGCAGGCGCTTGACGACTTGATCATGGGGGTTAGCAAGTCACGACGGCGT
ATATCACCATGAGCACAACCGCTTACAGCCCCAGAGACAAATAGCAGCAGCATCGTCTCAAAGCGCAGCGTCGAG
CGCCTATACCATTCCAAGGAGCCTCAGTTCTTTCGCTACTTCGTCGCCAATAACAAATTCCAACGCCGGTCGCCT
CTGATCAATCGCGGTTACTGGCTGAGGCTTAGGGCAATTGATCGTCTTGTTGGTCGCTTTCTCTCCCGTCCTTCG
TCAAAACCCAAGGTTGTGGTGAATCTTGGTTGTGGCAGGTCTGCTCGAGCTCCCCTATTCCAAAATCTTTTCCGC
TCATCGCGCCCATTAGCTTACGGCTACCAGCGATGCACTGCCATGGCAATGCCATGCTCGCTATCCATCTGCATG
CAATGGGGCTCTCTTTGTCGACATTGACTACCCCCAGCTCATGCTTAAGAAACGTCATGTCGTATTACAAACACC
CCAGCTAGAGGCTCTGACGAGAAACGGACTGTGCATCGACTTCACGCCCCTAGTATTACTCAAAAGCCAGTTATA
CTGCCAGCTTGGCTGTGACCTTCGCCAGCTCCATCATCTTGACCAGTCTCTGGCTTCCGTCCTGCCATCGCCCGA
TTGCGAGATACTGTTCGTGGCCGAAGTTTCTTTAACGTACATGGATACGTTGTCTGCAAATGCCCTATTAAAGTG
GGCCAGCTGTGTTTGTAGTGGTAAGATTGAGATACTTGTTCTGTCGTGAACTTACTGATTGGATTGTCTCTATGC
AGATGTCGAGTTTTGTTTATTGGAACAGATTCTTCCTCAAGGCCCCAATCACGCTTTTGCAAAAACAATGCTCGC
CCATTTTGACAAGCTGAAAACGCCGCCTAAATCAGTTCACCGCTACCAAACACTTGATTGTCAGCGAGCTCGTTT
CCAGAGTCATGGATGGAGAGCGGCACAAAGTTGGGACTTGTGGGATCTGTGGTCAAGCAACGACTTTGTCAGTCC
GACTGAGAGAATTGCATTGGACATGGTAGAGCCTTTTGACGAGTGGGAGGAGTTTATGCTCTTCGCACGTCACTA
CTGCCTTATTCACGCTTCCATGCCCACCTCCGCAAGCTGTCCCCGACCAGCCGACACGACGGAGAAGCCGACATG
TAATCAAGACGATTTCCAAGTACGTCGTCTCTTGGATAATGCCCCGAAACGACGCTTCGGCGATTGCTTGATGGC
TCCAAATACTCTTGGTGCCCAATATCTCATTCACATGATGGGGACAGGTACTAGCGGCAGGTGTGACAGCTATCA
CATATACTCGCTTAATGCAGATCTTCACATGGACCCTCCCAAGCTGCCCTTGTCGGGACCAACCCCTCGCGTCGC
ATTCAGCATGACAACGCTGGGCGATTTCGGAGTACTGCTTGTGGGCGGACGGAGCTCACCGTCAAGTCCATTATC
GGACTGTTGGATCTTTCTCAAAGAATCCCAGTGCCGCTGGCAAGCTACGTGGAAATTGCCCATTCCACTATTCAG
ACACTCAGCCGTCCGCCTCGCACGCTCATCTTTGGTTCTTGTTATGGGAGGCAAAACAGGCCCTTCATCAATATC
AGATGCCTCCTTCGTCTTTGATCCTCAAAGAGGCTGGTTAAAATGTCGACTTGAGGGTTCTGCTCCCCGTCCAAC
CTTTGGGGCACTTGCTATGTGCATGCCATGCCTATCCAGTAAAATTCCGGGCCTTTTTCAAGGCTTGTATGCCGG
CGGTATTGGCCAAGACGGTCGGGTTGCAACGGAGAAGTATGCCTGGCGTCTCCACTTCATGGCAAAGTCCGAGGT
AGGTTGTCCGTACTCAACTCCTGGCGCAGCTTGACTGATCAGTCGTTAGCCGACTATTCAATTCGAGCTACTCAA
TGCCAGCTTTGGAGCCAACACCAGCAGTGATTGCCTGGAGCTTTTTGGTGCCAAATGCGTCGACTTGGGCTCGCA
GGTGATGATATGCGGCGGCATGGGCCAGAATGCCTCATTTCAAGGCTACGACTTGATCCAGGTCACCACGACAGA
AGATGAATCGTACTCGATACAAAAACTCGGGCGAAAAGATGCTTCTTCAATGCCCTTTATAATTGGATCGTCACT
AATTGCCTCGGATAGGGGGTTCCTTATTATCGGTGGTGGGGCAACTTGCTTCTCCATGGGAACATTTTGGGAATC
AGGCTTTTACCATGTTGAGCTACATCAACCCAGTAATTGTTGGCGCGATGTAAGTTCTGCTACGAGTAGTAGGCT
TATATCGGAGGTTGAATTAGTAGAGACACGCAAAGTCGTTGTGAGTAATTCCAGCATTGGCCAAGACGTGCTGAG
TACGAAGGCGACGATGGCACCGATACCCAGAATTCAACTCGGACCCGACAAAACTTTTGATCAAGTCGCTAGCGA
AGGCAAACCCGTAGTCATTCAAGGTCTTGATATCGGGAGTTGCTTGGATAAGTGGACTTCTAGCTATATGGTGGA
GCGGGTGGGCAAAGCAACAGAGGTGAGATGCGTCCCAGACTTTCAGCTCAAGATACATGATTATGATTTCCAAGC
AAGGATGAAAACTGACAGTCTGGTAGGTTGTTGTCCATTGGTGCCAAAAAGATGACGAGAAGATGGACTTTAACT
CGAAAAACTTTGACTATATCAGCGATAGTTTTGAGAATGTCATGGCAAAGATGGAGGCCGGTGCTAGAATGTATC
TGAGGTGCTTGTCTCGAGATAAGCCAACGGAGCAGCCCGCAGACCTGGAAAAGGATTTCCCCCAACTCTCGCCAG
ACCTTTGTCTGCCCCCAGAATTGAGCATGGTCAAGGATCGGCTGTTTAGCTCAATACTGAGAGTGTCGGGCAGAG
TCACCATGTGGCTGCACTACGATGTATGTCTGGATTTTTCACTGTCCTTGTGACTCTAATCCTTGCTGACTTTTT
GCAATCATCTTGATAGGTCATGGCCAATGTGTATATGCAAATCAGGGGCGAGAGGCGCATGATGCTCTTCCCGCC
GAGCGATGTGCGCCACCTATCCTTGGCACCCGGTGCCTCGAGCTCAAGCGTAAACGTCTTTGACCATGTCGAGAC
TCTCGGCCTGGCAGCCACGCATCCGCACCACGCACTGCTCAAGCCAGGCGACGTGCTCTTCTTGCCTTCGCTGTG
GCTCCATTCAGGACAAGCCGTGTCGGATATGAGCGTGGCGGTCAATGTGTTTTTTAAACATCTCGACGGAGACTG
CTATGCGGCTGGCCGCGACGTTTACGGTAATAAAGACTTGGCGGCCTATGAGAGAGGGCGGCTCGACGTGGCTCG
CATAGCAAAGGCTTTTCGACACTTGCCCTTGGAAACAAGAGACTTTTACATGTCTCGCCTCGCGCAAGAGCTGGA
GCAGGCAGCACAAGATGGGCTGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail