Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2497
Gene name
LocationContig_18:83751..85851
Strand+
Gene length (bp)2100
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 9.0E-21 504 641

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38148|PPS1_YEAST Dual specificity protein phosphatase PPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPS1 PE=3 SV=1 338 674 5.0E-51
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 495 670 5.0E-17
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 495 643 4.0E-16
sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 495 643 5.0E-16
sp|Q64623|DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus GN=Dusp1 PE=1 SV=1 493 643 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38148|PPS1_YEAST Dual specificity protein phosphatase PPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPS1 PE=3 SV=1 338 674 5.0E-51
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 495 670 5.0E-17
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 495 643 4.0E-16
sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 495 643 5.0E-16
sp|Q64623|DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus GN=Dusp1 PE=1 SV=1 493 643 1.0E-15
sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 493 643 1.0E-15
sp|Q99956|DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens GN=DUSP9 PE=1 SV=1 491 644 1.0E-15
sp|P28563|DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus GN=Dusp1 PE=1 SV=1 497 643 1.0E-15
sp|Q13202|DUS8_HUMAN Dual specificity protein phosphatase 8 OS=Homo sapiens GN=DUSP8 PE=1 SV=2 498 644 2.0E-15
sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 498 644 2.0E-15
sp|Q16690|DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens GN=DUSP5 PE=1 SV=2 443 643 2.0E-15
sp|O54838|DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus GN=Dusp5 PE=2 SV=1 493 643 2.0E-15
sp|Q91790|DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis GN=dusp1-a PE=1 SV=1 493 643 3.0E-15
sp|Q9PW71|DUS4_CHICK Dual specificity protein phosphatase 4 OS=Gallus gallus GN=DUSP4 PE=2 SV=1 493 649 5.0E-15
sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 495 655 8.0E-15
sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 493 643 8.0E-15
sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 495 643 9.0E-15
sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 495 643 9.0E-15
sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 495 643 1.0E-14
sp|Q13115|DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens GN=DUSP4 PE=1 SV=1 493 649 1.0E-14
sp|Q05922|DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus GN=Dusp2 PE=1 SV=2 493 643 1.0E-14
sp|Q8BFV3|DUS4_MOUSE Dual specificity protein phosphatase 4 OS=Mus musculus GN=Dusp4 PE=2 SV=1 493 649 2.0E-14
sp|Q62767|DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus GN=Dusp4 PE=2 SV=1 493 649 2.0E-14
sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 493 651 2.0E-14
sp|Q05923|DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens GN=DUSP2 PE=1 SV=1 461 643 2.0E-14
sp|O55737|123R_IIV6 Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 GN=IIV6-123R PE=3 SV=1 497 650 3.0E-14
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 497 655 4.0E-14
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 489 647 4.0E-13
sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 498 644 2.0E-12
sp|Q76I76|SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens GN=SSH2 PE=1 SV=1 474 640 4.0E-12
sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 498 646 6.0E-12
sp|Q5SW75|SSH2_MOUSE Protein phosphatase Slingshot homolog 2 OS=Mus musculus GN=Ssh2 PE=1 SV=2 474 640 6.0E-12
sp|Q556Y8|DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum GN=DDB_G0273199 PE=3 SV=1 497 643 7.0E-12
sp|Q8WYL5|SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens GN=SSH1 PE=1 SV=2 497 640 1.0E-11
sp|Q6B8I1|DS13A_HUMAN Dual specificity protein phosphatase 13 isoform A OS=Homo sapiens GN=DUSP13 PE=1 SV=1 504 649 2.0E-11
sp|Q6B8I0|DS13A_MOUSE Dual specificity protein phosphatase 13 isoform A OS=Mus musculus GN=Dusp13 PE=2 SV=1 504 649 2.0E-11
sp|Q76I79|SSH1_MOUSE Protein phosphatase Slingshot homolog 1 OS=Mus musculus GN=Ssh1 PE=1 SV=1 497 640 2.0E-11
sp|Q99N11|DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus GN=Dusp22 PE=1 SV=1 494 642 4.0E-11
sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 504 644 1.0E-10
sp|Q6NN85|SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster GN=ssh PE=1 SV=2 497 636 1.0E-10
sp|Q10038|VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans GN=vhp-1 PE=1 SV=2 504 659 2.0E-10
sp|Q9NRW4|DUS22_HUMAN Dual specificity protein phosphatase 22 OS=Homo sapiens GN=DUSP22 PE=1 SV=1 494 642 6.0E-10
sp|Q0IID7|DUS10_BOVIN Dual specificity protein phosphatase 10 OS=Bos taurus GN=DUSP10 PE=2 SV=1 500 652 6.0E-10
sp|Q8R4V2|DUS15_MOUSE Dual specificity protein phosphatase 15 OS=Mus musculus GN=Dusp15 PE=2 SV=3 494 662 7.0E-10
sp|Q60969|STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus GN=Styx PE=1 SV=2 550 640 8.0E-10
sp|Q9Y6W6|DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens GN=DUSP10 PE=1 SV=1 500 652 1.0E-09
sp|Q9D0T2|DUS12_MOUSE Dual specificity protein phosphatase 12 OS=Mus musculus GN=Dusp12 PE=2 SV=1 504 655 1.0E-09
sp|Q9JIM4|DUS12_RAT Dual specificity protein phosphatase 12 OS=Rattus norvegicus GN=Dusp12 PE=2 SV=1 504 614 1.0E-09
sp|Q9ESS0|DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus GN=Dusp10 PE=2 SV=2 500 652 1.0E-09
sp|Q9JLY7|DUS14_MOUSE Dual specificity protein phosphatase 14 OS=Mus musculus GN=Dusp14 PE=2 SV=2 486 648 2.0E-09
sp|Q1LWL2|DS22A_DANRE Dual specificity protein phosphatase 22-A OS=Danio rerio GN=dusp22a PE=2 SV=2 494 640 3.0E-09
sp|Q566R7|DS22B_DANRE Dual specificity protein phosphatase 22-B OS=Danio rerio GN=dusp22b PE=2 SV=2 494 621 4.0E-09
sp|Q6AXW7|DUS18_RAT Dual specificity protein phosphatase 18 OS=Rattus norvegicus GN=Dusp18 PE=2 SV=1 498 648 1.0E-08
sp|Q17QM8|DUS14_BOVIN Dual specificity protein phosphatase 14 OS=Bos taurus GN=DUSP14 PE=2 SV=1 486 643 1.0E-08
sp|O95147|DUS14_HUMAN Dual specificity protein phosphatase 14 OS=Homo sapiens GN=DUSP14 PE=1 SV=1 486 643 1.0E-08
sp|Q8BTR5|DUS28_MOUSE Dual specificity phosphatase 28 OS=Mus musculus GN=Dusp28 PE=1 SV=1 498 644 2.0E-08
sp|Q6IVY4|SSH_XENLA Protein phosphatase Slingshot homolog OS=Xenopus laevis GN=ssh PE=1 SV=2 497 640 2.0E-08
sp|Q5U593|STYXB_XENLA Serine/threonine/tyrosine-interacting protein B OS=Xenopus laevis GN=styx-b PE=2 SV=1 550 640 3.0E-08
sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 488 641 4.0E-08
sp|Q5XHB2|DUS22_XENTR Dual specificity protein phosphatase 22 OS=Xenopus tropicalis GN=dusp22 PE=2 SV=1 494 642 4.0E-08
sp|Q4V7N3|STYXA_XENLA Serine/threonine/tyrosine-interacting protein A OS=Xenopus laevis GN=styx-a PE=2 SV=1 550 640 4.0E-08
sp|Q5RDP3|STYX_PONAB Serine/threonine/tyrosine-interacting protein OS=Pongo abelii GN=STYX PE=2 SV=1 550 640 5.0E-08
sp|Q8WUJ0|STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens GN=STYX PE=1 SV=1 550 640 5.0E-08
sp|Q9UNI6|DUS12_HUMAN Dual specificity protein phosphatase 12 OS=Homo sapiens GN=DUSP12 PE=1 SV=1 504 645 6.0E-08
sp|Q4G0W2|DUS28_HUMAN Dual specificity phosphatase 28 OS=Homo sapiens GN=DUSP28 PE=2 SV=1 499 644 6.0E-08
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 496 643 7.0E-08
sp|Q9BV47|DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens GN=DUSP26 PE=1 SV=1 504 645 9.0E-08
sp|Q5R6H6|DUS26_PONAB Dual specificity protein phosphatase 26 OS=Pongo abelii GN=DUSP26 PE=2 SV=1 504 645 9.0E-08
sp|Q5FVI9|DUS26_RAT Dual specificity protein phosphatase 26 OS=Rattus norvegicus GN=Dusp26 PE=2 SV=1 504 645 2.0E-07
sp|Q6GQJ8|DUS22_XENLA Dual specificity protein phosphatase 22 OS=Xenopus laevis GN=dusp22 PE=2 SV=1 494 636 2.0E-07
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 496 645 2.0E-07
sp|Q54R42|DUSP2_DICDI Probable dual specificity protein phosphatase DDB_G0283417 OS=Dictyostelium discoideum GN=DDB_G0283417 PE=3 SV=1 504 643 2.0E-07
sp|Q9D700|DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus GN=Dusp26 PE=2 SV=2 504 645 2.0E-07
sp|Q17QJ3|DUS26_BOVIN Dual specificity protein phosphatase 26 OS=Bos taurus GN=DUSP26 PE=2 SV=1 504 645 3.0E-07
sp|Q8K330|SSH3_MOUSE Protein phosphatase Slingshot homolog 3 OS=Mus musculus GN=Ssh3 PE=1 SV=1 498 655 5.0E-07
sp|Q8VE01|DUS18_MOUSE Dual specificity protein phosphatase 18 OS=Mus musculus GN=Dusp18 PE=1 SV=1 498 648 6.0E-07
sp|Q5XIS1|SSH3_RAT Protein phosphatase Slingshot homolog 3 OS=Rattus norvegicus GN=Ssh3 PE=1 SV=1 498 655 8.0E-07
sp|Q8NEJ0|DUS18_HUMAN Dual specificity protein phosphatase 18 OS=Homo sapiens GN=DUSP18 PE=1 SV=1 498 648 2.0E-06
sp|Q5R8X2|DUS18_PONAB Dual specificity protein phosphatase 18 OS=Pongo abelii GN=DUSP18 PE=2 SV=1 498 648 2.0E-06
sp|Q5RD73|DUS3_PONAB Dual specificity protein phosphatase 3 OS=Pongo abelii GN=DUSP3 PE=2 SV=1 495 643 2.0E-06
sp|P51452|DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens GN=DUSP3 PE=1 SV=1 495 643 2.0E-06
sp|Q9H596|DUS21_HUMAN Dual specificity protein phosphatase 21 OS=Homo sapiens GN=DUSP21 PE=1 SV=1 498 648 5.0E-06
sp|Q9D9D8|DUS21_MOUSE Dual specificity phosphatase 21 OS=Mus musculus GN=Dusp21 PE=1 SV=1 498 648 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0006793 phosphorus metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2695
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3328
Ophiocordyceps australis map64 (Brazil) OphauB2|2497 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04283
Ophiocordyceps camponoti-rufipedis Ophun1|2101
Ophiocordyceps kimflemingae Ophio5|8237
Ophiocordyceps subramaniannii Hirsu2|4205

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2497
MAARASAPDVATVMTPPHSLSNKHQSDPPPAGPTAPKATTCTPPPSPTTLDAVAQSSLLYPPHGYSRIDADALSV
YELNAEQVASALDYAARQPLPPPSSVFPWLHGLHPDNQLQQAFFAGHSSTPATIPVCLRGVVLVKADGQLDVACL
KGAIAPNHFMRPGTPTEFINADPPDGFSVRNFQIQPAKMALTSDIIVYDAQNPDEARKLAWDIAAAQLHWRDQHA
HKGHNLPRFHTFVCTSTMSEFEQRHPNLVSIDATGTATGKVLSFSQQERNEMWNMAEASQISFNVYMGPTPEPGS
SEEESFDMLVECSDLGRLNPSALRSLVEDPNGENLGRISLDFPSSGSILPPAWSHEEADGILETCRWLFHLAHGT
CPDVQHSHGLPQSRSPATPTVRQRRPRKILIHCTDGYTESTLLGIAYLSYSAGIPVPEAWLRLHTCKHRDFFAYP
TDVALLTAIAPRLLQESPASAGRSFRDITNMVKDEPRWLQGLDGSLPSRILKYLYLGNLGHANNPHLLANLGIRQ
VLSVGETALWRDGDRDEWGAENICVVQGVQDNGIDSLTDHFARCLEFIDRGRRNGTATLVHCRVGVSRSATICIA
EVMRSLNLSFPRAYCFVRARRLNVIIQPHLRFVYELLRWEEHLRQTNSSYTPTQREMEWGEIAHEIALINRPYSR
*
Coding >OphauB2|2497
ATGGCTGCTCGCGCTTCAGCGCCCGACGTGGCGACTGTCATGACTCCGCCGCATTCGCTATCCAACAAGCATCAA
TCCGACCCCCCCCCTGCTGGCCCCACTGCCCCCAAGGCGACGACGTGCACTCCGCCTCCCTCGCCCACGACGCTC
GATGCTGTTGCTCAGAGCTCCTTGCTTTATCCTCCCCATGGCTATTCCCGCATCGATGCCGACGCCCTGTCGGTA
TACGAGCTGAATGCGGAGCAGGTTGCCAGCGCCCTCGACTATGCTGCCCGCCAGCCCCTGCCCCCGCCATCTTCA
GTCTTTCCCTGGCTCCATGGCTTGCATCCTGACAATCAGCTCCAGCAGGCCTTTTTTGCCGGCCACTCCTCAACC
CCCGCAACAATCCCAGTCTGTCTCCGAGGCGTTGTCCTCGTCAAGGCCGATGGTCAACTCGACGTGGCTTGCCTC
AAGGGCGCCATAGCCCCCAACCACTTTATGCGGCCTGGTACCCCTACTGAGTTTATCAATGCCGACCCTCCTGAT
GGCTTCTCGGTCCGCAATTTCCAGATCCAGCCCGCCAAAATGGCTCTGACTTCGGACATTATTGTCTATGATGCC
CAAAACCCTGACGAGGCGCGCAAGCTGGCATGGGATATAGCCGCCGCTCAGCTACACTGGCGCGACCAGCACGCG
CACAAGGGGCACAATTTGCCACGCTTTCACACCTTTGTCTGCACAAGCACCATGTCCGAGTTTGAGCAGCGACAC
CCCAATCTCGTCTCTATTGATGCTACGGGAACCGCCACGGGCAAGGTTCTCAGCTTTAGCCAGCAGGAACGAAAT
GAAATGTGGAACATGGCTGAAGCGTCCCAAATCTCTTTCAACGTCTACATGGGCCCGACGCCTGAGCCTGGCAGC
TCTGAAGAAGAGTCGTTTGACATGCTTGTCGAATGCAGTGACCTGGGCCGCTTGAATCCCTCAGCTCTACGATCT
TTGGTTGAGGATCCCAATGGCGAAAACCTTGGCCGCATATCCCTCGACTTCCCTTCATCCGGAAGCATATTGCCT
CCAGCGTGGTCCCACGAGGAGGCGGACGGCATCCTTGAAACTTGCCGCTGGCTATTCCACCTGGCCCATGGAACC
TGTCCAGATGTGCAGCATTCCCACGGCTTGCCTCAGTCCCGCAGCCCAGCCACGCCAACTGTGAGACAACGGCGG
CCACGCAAGATACTCATTCACTGCACAGACGGTTATACCGAATCGACCTTGTTGGGCATTGCCTATCTCAGCTAT
AGCGCAGGCATTCCAGTTCCAGAAGCATGGCTCAGGCTTCACACATGCAAGCATCGCGATTTCTTTGCCTACCCA
ACTGATGTGGCCTTGCTCACCGCCATTGCCCCTCGCCTTTTGCAAGAGTCGCCCGCCAGCGCGGGCCGCAGTTTT
CGCGACATTACAAACATGGTCAAGGACGAGCCCCGGTGGCTCCAGGGCTTGGATGGCTCCTTACCCAGCAGGATT
TTGAAGTACCTTTACCTCGGCAACTTGGGGCATGCCAACAATCCCCATCTCCTTGCCAATCTTGGAATAAGACAG
GTGCTTAGTGTTGGCGAGACGGCTTTGTGGCGCGACGGCGACAGGGACGAATGGGGCGCGGAAAACATATGTGTC
GTGCAAGGGGTGCAAGACAATGGCATAGACTCGTTGACGGATCACTTTGCTCGATGCCTCGAATTTATTGATCGA
GGCAGACGCAACGGCACCGCCACATTGGTGCATTGTCGGGTAGGCGTTTCTCGCAGCGCAACTATTTGCATTGCA
GAGGTGATGCGCTCTCTCAACCTGTCCTTTCCTCGTGCCTATTGCTTCGTGAGGGCCCGGCGGCTCAATGTCATT
ATCCAGCCTCACCTACGCTTTGTCTATGAATTGCTGAGATGGGAAGAGCATCTTCGGCAGACCAACTCTTCTTAT
ACACCTACCCAGAGAGAAATGGAGTGGGGAGAAATTGCTCACGAAATTGCCCTCATTAACCGCCCTTATTCTAGA
TGA
Transcript >OphauB2|2497
ATGGCTGCTCGCGCTTCAGCGCCCGACGTGGCGACTGTCATGACTCCGCCGCATTCGCTATCCAACAAGCATCAA
TCCGACCCCCCCCCTGCTGGCCCCACTGCCCCCAAGGCGACGACGTGCACTCCGCCTCCCTCGCCCACGACGCTC
GATGCTGTTGCTCAGAGCTCCTTGCTTTATCCTCCCCATGGCTATTCCCGCATCGATGCCGACGCCCTGTCGGTA
TACGAGCTGAATGCGGAGCAGGTTGCCAGCGCCCTCGACTATGCTGCCCGCCAGCCCCTGCCCCCGCCATCTTCA
GTCTTTCCCTGGCTCCATGGCTTGCATCCTGACAATCAGCTCCAGCAGGCCTTTTTTGCCGGCCACTCCTCAACC
CCCGCAACAATCCCAGTCTGTCTCCGAGGCGTTGTCCTCGTCAAGGCCGATGGTCAACTCGACGTGGCTTGCCTC
AAGGGCGCCATAGCCCCCAACCACTTTATGCGGCCTGGTACCCCTACTGAGTTTATCAATGCCGACCCTCCTGAT
GGCTTCTCGGTCCGCAATTTCCAGATCCAGCCCGCCAAAATGGCTCTGACTTCGGACATTATTGTCTATGATGCC
CAAAACCCTGACGAGGCGCGCAAGCTGGCATGGGATATAGCCGCCGCTCAGCTACACTGGCGCGACCAGCACGCG
CACAAGGGGCACAATTTGCCACGCTTTCACACCTTTGTCTGCACAAGCACCATGTCCGAGTTTGAGCAGCGACAC
CCCAATCTCGTCTCTATTGATGCTACGGGAACCGCCACGGGCAAGGTTCTCAGCTTTAGCCAGCAGGAACGAAAT
GAAATGTGGAACATGGCTGAAGCGTCCCAAATCTCTTTCAACGTCTACATGGGCCCGACGCCTGAGCCTGGCAGC
TCTGAAGAAGAGTCGTTTGACATGCTTGTCGAATGCAGTGACCTGGGCCGCTTGAATCCCTCAGCTCTACGATCT
TTGGTTGAGGATCCCAATGGCGAAAACCTTGGCCGCATATCCCTCGACTTCCCTTCATCCGGAAGCATATTGCCT
CCAGCGTGGTCCCACGAGGAGGCGGACGGCATCCTTGAAACTTGCCGCTGGCTATTCCACCTGGCCCATGGAACC
TGTCCAGATGTGCAGCATTCCCACGGCTTGCCTCAGTCCCGCAGCCCAGCCACGCCAACTGTGAGACAACGGCGG
CCACGCAAGATACTCATTCACTGCACAGACGGTTATACCGAATCGACCTTGTTGGGCATTGCCTATCTCAGCTAT
AGCGCAGGCATTCCAGTTCCAGAAGCATGGCTCAGGCTTCACACATGCAAGCATCGCGATTTCTTTGCCTACCCA
ACTGATGTGGCCTTGCTCACCGCCATTGCCCCTCGCCTTTTGCAAGAGTCGCCCGCCAGCGCGGGCCGCAGTTTT
CGCGACATTACAAACATGGTCAAGGACGAGCCCCGGTGGCTCCAGGGCTTGGATGGCTCCTTACCCAGCAGGATT
TTGAAGTACCTTTACCTCGGCAACTTGGGGCATGCCAACAATCCCCATCTCCTTGCCAATCTTGGAATAAGACAG
GTGCTTAGTGTTGGCGAGACGGCTTTGTGGCGCGACGGCGACAGGGACGAATGGGGCGCGGAAAACATATGTGTC
GTGCAAGGGGTGCAAGACAATGGCATAGACTCGTTGACGGATCACTTTGCTCGATGCCTCGAATTTATTGATCGA
GGCAGACGCAACGGCACCGCCACATTGGTGCATTGTCGGGTAGGCGTTTCTCGCAGCGCAACTATTTGCATTGCA
GAGGTGATGCGCTCTCTCAACCTGTCCTTTCCTCGTGCCTATTGCTTCGTGAGGGCCCGGCGGCTCAATGTCATT
ATCCAGCCTCACCTACGCTTTGTCTATGAATTGCTGAGATGGGAAGAGCATCTTCGGCAGACCAACTCTTCTTAT
ACACCTACCCAGAGAGAAATGGAGTGGGGAGAAATTGCTCACGAAATTGCCCTCATTAACCGCCCTTATTCTAGA
TGA
Gene >OphauB2|2497
ATGGCTGCTCGCGCTTCAGCGCCCGACGTGGCGACTGTCATGACTCCGCCGCATTCGCTATCCAACAAGCATCAA
TCCGACCCCCCCCCTGCTGGCCCCACTGCCCCCAAGGCGACGACGTGCACTCCGCCTCCCTCGCCCACGACGCTC
GATGCTGTTGCTCAGAGCTCCTTGCTTTATCCTCCCCATGGCTATTCCCGCATCGATGCCGACGCCCTGTCGGTA
TACGAGCTGAATGCGGAGCAGGTTGCCAGCGCCCTCGACTATGCTGCCCGCCAGCCCCTGCCCCCGCCATCTTCA
GTCTTTCCCTGGCTCCATGGCTTGCATCCTGACAATCAGCTCCAGCAGGCCTTTTTTGCCGGCCACTCCTCAACC
CCCGCAACAATCCCAGTCTGTCTCCGAGGCGTTGTCCTCGTCAAGGCCGATGGTCAACTCGACGTGGCTTGCCTC
AAGGGCGCCATAGCCCCCAACCACTTTATGCGGCCTGGTACCCCTACTGAGTTTATCAATGCCGACCCTCCTGAT
GGCTTCTCGGTCCGCAATTTCCAGATCCAGCCCGCCAAAATGGCTCTGACTTCGGACATTATTGTCTATGATGCC
CAAAACCCTGACGAGGCGCGCAAGCTGGCATGGGATATAGCCGCCGCTCAGCTACACTGGCGCGACCAGCACGCG
CACAAGGGGCACAATTTGCCACGCTTTCACACCTTTGTCTGCACAAGCACCATGTCCGAGTTTGAGCAGCGACAC
CCCAATCTCGTCTCTATTGATGCTACGGGAACCGCCACGGGCAAGGTTCTCAGCTTTAGCCAGCAGGAACGAAAT
GAAATGTGGAACATGGCTGAAGCGTCCCAAATCTCTTTCAACGTCTACATGGGCCCGACGCCTGAGCCTGGCAGC
TCTGAAGAAGAGTCGTTTGACATGCTTGTCGAATGCAGTGACCTGGGCCGCTTGAATCCCTCAGCTCTACGATCT
TTGGTTGAGGATCCCAATGGCGAAAACCTTGGCCGCATATCCCTCGACTTCCCTTCATCCGGAAGCATATTGCCT
CCAGCGTGGTCCCACGAGGAGGCGGACGGCATCCTTGAAACTTGCCGCTGGCTATTCCACCTGGCCCATGGAACC
TGTCCAGATGTGCAGCATTCCCACGGCTTGCCTCAGTCCCGCAGCCCAGCCACGCCAACTGTGAGACAACGGCGG
CCACGCAAGATACTCATTCACTGCACAGACGGTTATACCGAATCGACCTTGTTGGGCATTGCCTATCTCAGCTAT
AGCGCAGGCATTCCAGTTCCAGAAGCATGGCTCAGGCTTCACACATGCAAGCATCGCGATTTCTTTGCCTACCCA
ACTGATGTGGCCTTGCTCACCGCCATTGCCCCTCGCCTTTTGCAAGAGTCGCCCGCCAGCGCGGGCCGCAGTTTT
CGCGACATTACAAACATGGTCAAGGACGAGCCCCGGTGGCTCCAGGGCTTGGATGGCTCCTTACCCAGCAGGATT
TTGAAGTACCTTTACCTCGGCAACTTGGGGCATGCCAACAATCCCCATCTCCTTGCCAATCTTGGAATAAGACAG
GTGCTTAGTGTTGGCGAGACGGCTTTGTGGCGCGACGGCGACAGGGACGAATGGGGCGCGGAAAACATATGTGTC
GTGCAAGGGGTGCAAGACAATGGCATAGACTCGTTGACGGATCACTTTGCTCGATGCCTCGAATTTATTGGTGAG
TTGTGGCCCCCAACTACCCCTCCTCATTGACTCGCGTCAGAGATGCTCATCGTCTTTGCCATGCCAGATCGAGGC
AGACGCAACGGCACCGCCACATTGGTGCATTGTCGGGTAGGCGTTTCTCGCAGCGCAACTATTTGCATTGCAGAG
GTGATGCGCTCTCTCAACCTGTCCTTTCCTCGTGCCTATTGCTTCGTGAGGGCCCGGCGGCTCAATGTCATTATC
CAGCCTCACCTACGCTTTGTCTATGAATTGCTGAGATGGGAAGAGCATCTTCGGCAGACCAACTCTTCTTATACA
CCTACCCAGAGAGAAATGGAGTGGGGAGAAATTGCTCACGAAATTGCCCTCATTAACCGCCCTTATTCTAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail