© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|2491 |
| Gene name | |
| Location | Contig_18:66974..67350 |
| Strand | - |
| Gene length (bp) | 376 |
| Transcript length (bp) | 312 |
| Coding sequence length (bp) | 312 |
| Protein length (aa) | 104 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF15511 | CENP-T_C | Centromere kinetochore component CENP-T histone fold | 3.5E-08 | 32 | 96 |
| PF02969 | TAF | TATA box binding protein associated factor (TAF) | 8.0E-05 | 31 | 92 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P04914|H4_NEUCR | Histone H4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH4-1 PE=3 SV=2 | 1 | 103 | 1.0E-65 |
| sp|Q7LKT3|H4_ASPFU | Histone H4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hhfA PE=3 SV=3 | 1 | 103 | 1.0E-65 |
| sp|Q711M0|H41_TALFU | Histone H4.1 OS=Talaromyces funiculosus GN=H4.1 PE=3 SV=3 | 1 | 103 | 1.0E-65 |
| sp|Q76MU7|H4_ASPOR | Histone H4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hhfA PE=3 SV=3 | 1 | 103 | 3.0E-65 |
| sp|P23750|H41_EMENI | Histone H4.1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfA PE=3 SV=2 | 1 | 103 | 3.0E-65 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P04914|H4_NEUCR | Histone H4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH4-1 PE=3 SV=2 | 1 | 103 | 1.0E-65 |
| sp|Q7LKT3|H4_ASPFU | Histone H4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hhfA PE=3 SV=3 | 1 | 103 | 1.0E-65 |
| sp|Q711M0|H41_TALFU | Histone H4.1 OS=Talaromyces funiculosus GN=H4.1 PE=3 SV=3 | 1 | 103 | 1.0E-65 |
| sp|Q76MU7|H4_ASPOR | Histone H4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hhfA PE=3 SV=3 | 1 | 103 | 3.0E-65 |
| sp|P23750|H41_EMENI | Histone H4.1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfA PE=3 SV=2 | 1 | 103 | 3.0E-65 |
| sp|Q8NIQ8|H42_TALFU | Histone H4.2 OS=Talaromyces funiculosus GN=H4.2 PE=3 SV=3 | 1 | 103 | 1.0E-64 |
| sp|Q9U7D0|H4_MASBA | Histone H4 OS=Mastigamoeba balamuthi PE=3 SV=3 | 1 | 103 | 2.0E-54 |
| sp|P23751|H42_EMENI | Histone H4.2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfB PE=3 SV=2 | 18 | 103 | 2.0E-53 |
| sp|Q8J1L3|H4_BLAAD | Histone H4 OS=Blastobotrys adeninivorans GN=ahsb4 PE=3 SV=3 | 18 | 103 | 7.0E-53 |
| sp|P62791|H4_STYLE | Histone H4 OS=Stylonychia lemnae PE=3 SV=2 | 1 | 103 | 1.0E-51 |
| sp|P62790|H4_STENO | Histone H4 OS=Sterkiella nova PE=3 SV=2 | 1 | 103 | 1.0E-51 |
| sp|Q9HDF5|H4_MORAP | Histone H4 OS=Mortierella alpina GN=H4.1 PE=3 SV=3 | 18 | 103 | 4.0E-51 |
| sp|P09322|H4_SCHPO | Histone H4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhf1 PE=1 SV=2 | 18 | 103 | 6.0E-51 |
| sp|Q27765|H4_STYPL | Histone H4 OS=Styela plicata PE=3 SV=3 | 18 | 103 | 8.0E-51 |
| sp|Q8I0Y4|H4_OIKDI | Histone H4 OS=Oikopleura dioica GN=H4.1 PE=3 SV=3 | 18 | 103 | 8.0E-51 |
| sp|Q6LAF1|H4_DENKL | Histone H4 OS=Dendronephthya klunzingeri GN=H4DEKL PE=3 SV=3 | 18 | 103 | 9.0E-51 |
| sp|P35059|H4_ACRFO | Histone H4 OS=Acropora formosa PE=3 SV=2 | 18 | 103 | 9.0E-51 |
| sp|Q8NIG3|H4_CANGA | Histone H4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HHF1 PE=3 SV=3 | 18 | 103 | 1.0E-50 |
| sp|P04915|H4_PHYPO | Histone H4 OS=Physarum polycephalum GN=H41 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q28DR4|H4_XENTR | Histone H4 OS=Xenopus tropicalis GN=TGas006m08.1 PE=3 SV=1 | 18 | 103 | 2.0E-50 |
| sp|P62799|H4_XENLA | Histone H4 OS=Xenopus laevis PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62798|H4_XENBO | Histone H4 OS=Xenopus borealis PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62794|H4_URECA | Histone H4 OS=Urechis caupo PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62804|H4_RAT | Histone H4 OS=Rattus norvegicus GN=Hist1h4b PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q5RCS7|H4_PONAB | Histone H4 OS=Pongo abelii PE=3 SV=1 | 18 | 103 | 2.0E-50 |
| sp|P62795|H4_PLADU | Histone H4 OS=Platynereis dumerilii PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62802|H4_PIG | Histone H4 OS=Sus scrofa PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62796|H4_ORENI | Histone H4 OS=Oreochromis niloticus PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62797|H4_ONCMY | Histone H4 OS=Oncorhynchus mykiss PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q6WV72|H4_MYTTR | Histone H4 OS=Mytilus trossulus PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|Q6WV90|H4_MYTGA | Histone H4 OS=Mytilus galloprovincialis PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|Q7K8C0|H4_MYTED | Histone H4 OS=Mytilus edulis PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|Q6WV73|H4_MYTCA | Histone H4 OS=Mytilus californianus PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|P62806|H4_MOUSE | Histone H4 OS=Mus musculus GN=Hist1h4a PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q4R362|H4_MACFA | Histone H4 OS=Macaca fascicularis GN=QtsA-19327 PE=3 SV=1 | 18 | 103 | 2.0E-50 |
| sp|P62805|H4_HUMAN | Histone H4 OS=Homo sapiens GN=HIST1H4A PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62801|H4_CHICK | Histone H4 OS=Gallus gallus GN=H4-I PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q7KQD1|H4_CHAVR | Histone H4 OS=Chaetopterus variopedatus PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|P62800|H4_CAIMO | Histone H4 OS=Cairina moschata PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P62803|H4_BOVIN | Histone H4 OS=Bos taurus PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P27996|H4_SOLST | Histone H4 OS=Solaster stimpsoni PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84045|H4_TIGCA | Histone H4 OS=Tigriopus californicus GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84050|H4_RHYAM | Histone H4 OS=Rhynchosciara americana GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84049|H4_MYRRU | Histone H4 OS=Myrmica ruginodis GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84044|H4_DROYA | Histone H4 OS=Drosophila yakuba GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q76FF5|H4_DROTE | Histone H4 OS=Drosophila teissieri GN=His4 PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|P84043|H4_DROSI | Histone H4 OS=Drosophila simulans GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q76FD9|H4_DROSE | Histone H4 OS=Drosophila sechellia GN=His4 PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|Q76FF1|H4_DROOR | Histone H4 OS=Drosophila orena GN=His4 PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|P84040|H4_DROME | Histone H4 OS=Drosophila melanogaster GN=His4 PE=1 SV=2 | 18 | 103 | 2.0E-50 |
| sp|Q76FE7|H4_DROMA | Histone H4 OS=Drosophila mauritiana GN=His4 PE=3 SV=3 | 18 | 103 | 2.0E-50 |
| sp|P84042|H4_DROHY | Histone H4 OS=Drosophila hydei GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84041|H4_DROER | Histone H4 OS=Drosophila erecta GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84046|H4_CHITH | Histone H4 OS=Chironomus thummi thummi GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84047|H4_ASEAQ | Histone H4 OS=Asellus aquaticus GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P84048|H4_ACRAS | Histone H4 OS=Acrolepiopsis assectella GN=His4 PE=3 SV=2 | 18 | 103 | 2.0E-50 |
| sp|P02309|H4_YEAST | Histone H4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HHF1 PE=1 SV=2 | 18 | 103 | 3.0E-50 |
| sp|Q75AX1|H42_ASHGO | Histone H4.2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HHF2 PE=3 SV=4 | 18 | 103 | 4.0E-50 |
| sp|Q757K0|H41_ASHGO | Histone H4.1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HHF1 PE=3 SV=3 | 18 | 103 | 4.0E-50 |
| sp|Q6WV74|H4_MYTCH | Histone H4 OS=Mytilus chilensis PE=3 SV=3 | 18 | 103 | 4.0E-50 |
| sp|Q6ZXX3|H4_USTMA | Histone H4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HHF1 PE=3 SV=4 | 18 | 103 | 6.0E-50 |
| sp|P62783|H4_STRPU | Histone H4 OS=Strongylocentrotus purpuratus PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62779|H4_PYCHE | Histone H4 OS=Pycnopodia helianthoides PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62781|H4_PSAMI | Histone H4 OS=Psammechinus miliaris PE=1 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62778|H4_PISOC | Histone H4 OS=Pisaster ochraceus PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62777|H4_PISBR | Histone H4 OS=Pisaster brevispinus PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62780|H4_PARLI | Histone H4 OS=Paracentrotus lividus PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62782|H4_LYTPI | Histone H4 OS=Lytechinus pictus PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62776|H4_HOLTU | Histone H4 OS=Holothuria tubulosa PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62784|H4_CAEEL | Histone H4 OS=Caenorhabditis elegans GN=his-1 PE=1 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P0CG89|H4_SOYBN | Histone H4 OS=Glycine max PE=3 SV=1 | 18 | 103 | 6.0E-50 |
| sp|Q76H85|H4_SILLA | Histone H4 OS=Silene latifolia GN=SlH4 PE=3 SV=3 | 18 | 103 | 6.0E-50 |
| sp|P62788|H4_PEA | Histone H4 OS=Pisum sativum PE=1 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62787|H4_MAIZE | Histone H4 OS=Zea mays GN=H4C7 PE=1 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62887|H4_LOLTE | Histone H4 OS=Lolium temulentum PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|Q6LAF3|H4_FLATR | Histone H4 OS=Flaveria trinervia GN=hh4 PE=3 SV=3 | 18 | 103 | 6.0E-50 |
| sp|Q6WZ83|H4_EUCGL | Histone H4 OS=Eucalyptus globulus PE=3 SV=3 | 18 | 103 | 6.0E-50 |
| sp|Q6PMI5|H4_CHEMJ | Histone H4 OS=Chelidonium majus PE=3 SV=3 | 18 | 103 | 6.0E-50 |
| sp|P59259|H4_ARATH | Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE=1 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62786|H42_WHEAT | Histone H4 variant TH091 OS=Triticum aestivum PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P62785|H41_WHEAT | Histone H4 variant TH011 OS=Triticum aestivum PE=3 SV=2 | 18 | 103 | 6.0E-50 |
| sp|P70081|H48_CHICK | Histone H4 type VIII OS=Gallus gallus GN=H4-VIII PE=3 SV=3 | 18 | 103 | 1.0E-49 |
| sp|P82888|H4_OLILU | Histone H4 OS=Olisthodiscus luteus PE=1 SV=2 | 18 | 103 | 1.0E-49 |
| sp|Q8MTV8|H4_APLCA | Histone H4 OS=Aplysia californica GN=His.H4 PE=3 SV=3 | 18 | 103 | 1.0E-49 |
| sp|Q43083|H4_PYRSA | Histone H4 OS=Pyrenomonas salina PE=3 SV=3 | 18 | 103 | 1.0E-49 |
| sp|P35057|H4_SOLLC | Histone H4 OS=Solanum lycopersicum PE=3 SV=2 | 18 | 103 | 2.0E-49 |
| sp|Q6V9I2|H4_SOLCH | Histone H4 OS=Solanum chacoense PE=3 SV=3 | 18 | 103 | 2.0E-49 |
| sp|Q71V09|H4_CAPAN | Histone H4 OS=Capsicum annuum PE=3 SV=3 | 18 | 103 | 2.0E-49 |
| sp|P50566|H4_CHLRE | Histone H4 OS=Chlamydomonas reinhardtii GN=H4-I PE=3 SV=2 | 18 | 103 | 2.0E-49 |
| sp|P91882|H4_DIAPU | Histone H4 OS=Diadromus pulchellus PE=3 SV=3 | 18 | 103 | 2.0E-49 |
| sp|P91890|H4_TRICD | Histone H4 OS=Trichogramma cacoeciae PE=3 SV=3 | 18 | 103 | 3.0E-49 |
| sp|P62792|H4_PHACH | Histone H4 OS=Phanerochaete chrysosporium GN=H4.1 PE=3 SV=2 | 18 | 103 | 3.0E-49 |
| sp|P62793|H4_AGABI | Histone H4 OS=Agaricus bisporus GN=hhfA PE=3 SV=2 | 18 | 103 | 3.0E-49 |
| sp|P08436|H4_VOLCA | Histone H4 OS=Volvox carteri GN=H4-I PE=3 SV=2 | 18 | 103 | 6.0E-49 |
| sp|Q41811|H43_MAIZE | Histone H4.3 OS=Zea mays GN=H4 PE=1 SV=3 | 18 | 103 | 1.0E-48 |
| sp|Q27443|H4_ASCSU | Histone H4 OS=Ascaris suum PE=3 SV=2 | 18 | 103 | 1.0E-48 |
| sp|P83865|H4_LITVA | Histone H4 OS=Litopenaeus vannamei PE=1 SV=2 | 18 | 103 | 1.0E-47 |
| sp|Q8T7J8|H4_EIMTE | Histone H4 OS=Eimeria tenella PE=3 SV=3 | 18 | 103 | 2.0E-47 |
| sp|P91849|H4_APIME | Histone H4 OS=Apis mellifera PE=3 SV=3 | 18 | 103 | 3.0E-47 |
| sp|P80739|H4_EUPCR | Histone H4 OS=Euplotes crassus PE=1 SV=3 | 18 | 103 | 3.0E-43 |
| sp|Q76NW2|H4_DICDI | Histone H4 OS=Dictyostelium discoideum GN=H4a PE=1 SV=1 | 16 | 103 | 1.0E-41 |
| sp|P69152|H4_TETTS | Histone H4 OS=Tetrahymena thermophila (strain SB210) GN=HHF1 PE=1 SV=2 | 18 | 103 | 2.0E-41 |
| sp|P69151|H42_TETPY | Histone H4, minor OS=Tetrahymena pyriformis PE=1 SV=2 | 18 | 103 | 2.0E-41 |
| sp|P90516|H42_BLEJA | Histone H4 (Fragment) OS=Blepharisma japonicum GN=H4 PE=3 SV=1 | 9 | 95 | 4.0E-41 |
| sp|P02310|H41_TETPY | Histone H4, major OS=Tetrahymena pyriformis PE=1 SV=2 | 26 | 103 | 6.0E-41 |
| sp|P40287|H4_ENTHI | Histone H4 OS=Entamoeba histolytica PE=3 SV=1 | 3 | 102 | 1.0E-40 |
| sp|P80737|H41_BLEJA | Histone H4-1 (Fragment) OS=Blepharisma japonicum PE=1 SV=3 | 18 | 95 | 6.0E-39 |
| sp|Q99525|H4G_HUMAN | Histone H4-like protein type G OS=Homo sapiens GN=HIST1H4G PE=1 SV=1 | 19 | 98 | 4.0E-34 |
| sp|Q8SQP4|H4_ENCCU | Histone H4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HHF1 PE=3 SV=1 | 5 | 101 | 2.0E-16 |
| sp|P80738|H4Y_BLEJA | Histone H4 (Fragment) OS=Blepharisma japonicum PE=1 SV=2 | 18 | 45 | 2.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0006352 | DNA-templated transcription, initiation | Yes |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0034654 | nucleobase-containing compound biosynthetic process | No |
| GO:0008150 | biological_process | No |
| GO:0009059 | macromolecule biosynthetic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0018130 | heterocycle biosynthetic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0019438 | aromatic compound biosynthetic process | No |
| GO:0006139 | nucleobase-containing compound metabolic process | No |
| GO:0090304 | nucleic acid metabolic process | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0032774 | RNA biosynthetic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:0009987 | cellular process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0009058 | biosynthetic process | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:0016070 | RNA metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 41 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|2491 MTGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYTE HAKRKTVTSLDVVYALKRQGRTLYGFGG* |
| Coding | >OphauB2|2491 ATGACTGGACGCGGCAAAGGTGGCAAGGGCCTTGGCAAGGGCGGTGCGAAGCGTCATCGTAAGATTCTTCGCGAC AACATCCAGGGCATCACAAAGCCTGCCATTAGACGTCTGGCACGTCGTGGAGGCGTCAAGCGTATCTCGGCCATG ATTTACGAAGAGACACGTGGCGTACTCAAGACGTTTCTCGAGGGCGTTATCCGTGACGCCGTGACATATACTGAG CACGCCAAGCGCAAGACGGTCACGTCTCTGGATGTCGTCTATGCACTGAAACGCCAGGGCCGTACTCTGTACGGT TTTGGTGGTTAA |
| Transcript | >OphauB2|2491 ATGACTGGACGCGGCAAAGGTGGCAAGGGCCTTGGCAAGGGCGGTGCGAAGCGTCATCGTAAGATTCTTCGCGAC AACATCCAGGGCATCACAAAGCCTGCCATTAGACGTCTGGCACGTCGTGGAGGCGTCAAGCGTATCTCGGCCATG ATTTACGAAGAGACACGTGGCGTACTCAAGACGTTTCTCGAGGGCGTTATCCGTGACGCCGTGACATATACTGAG CACGCCAAGCGCAAGACGGTCACGTCTCTGGATGTCGTCTATGCACTGAAACGCCAGGGCCGTACTCTGTACGGT TTTGGTGGTTAA |
| Gene | >OphauB2|2491 ATGACTGGACGCGGCAAAGGTGGCAAGGGCCTTGGCAAGGGCGGTGCGAAGCGTCATCGTAAGATTCTTCGCGAC AACATCCAGGGCATCACAAAGCCTGCCATTAGACGTCTGGCACGTCGTGGAGGCGTCAAGCGTATCTCGGCCAGT ACGTAATAATCCGTCTCCCTCTTGTTGCCGTCATGGCACAGCTTGCTAACGGCGACGTATAGTGATTTACGAAGA GACACGTGGCGTACTCAAGACGTTTCTCGAGGGCGTTATCCGTGACGCCGTGACATATACTGAGCACGCCAAGCG CAAGACGGTCACGTCTCTGGATGTCGTCTATGCACTGAAACGCCAGGGCCGTACTCTGTACGGTTTTGGTGGTTA A |