Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|248
Gene name
LocationContig_10:243209..243712
Strand-
Gene length (bp)503
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999608

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6181
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|248 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7177
Ophiocordyceps kimflemingae Ophio5|2492
Ophiocordyceps kimflemingae Ophio5|7929
Ophiocordyceps subramaniannii Hirsu2|5580

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|248
MHITKVLALAFASSALAADTAASYLGIAYSQPQYRGYSQTIGNHEAGRCVNLDRGVRNDVESVRVSRGVRCTYWN
DQYCRGHSDSYQQDDGYVRGKKYDSVRCEYWRR*
Coding >OphauB2|248
ATGCACATTACCAAGGTTCTCGCTCTGGCCTTTGCGTCGTCGGCACTGGCAGCCGACACTGCCGCTAGCTATCTT
GGCATCGCATACAGCCAGCCGCAGTACCGCGGATACTCGCAAACCATTGGCAACCACGAAGCCGGCCGCTGCGTC
AATCTTGATCGCGGCGTACGCAACGATGTCGAGTCTGTGCGTGTGTCTCGAGGTGTTCGCTGCACGTACTGGAAT
GATCAGTACTGCCGCGGGCACTCGGATTCGTATCAGCAGGATGATGGCTACGTGCGCGGCAAAAAGTACGACTCT
GTGCGGTGCGAGTACTGGAGACGCTAG
Transcript >OphauB2|248
ATGCACATTACCAAGGTTCTCGCTCTGGCCTTTGCGTCGTCGGCACTGGCAGCCGACACTGCCGCTAGCTATCTT
GGCATCGCATACAGCCAGCCGCAGTACCGCGGATACTCGCAAACCATTGGCAACCACGAAGCCGGCCGCTGCGTC
AATCTTGATCGCGGCGTACGCAACGATGTCGAGTCTGTGCGTGTGTCTCGAGGTGTTCGCTGCACGTACTGGAAT
GATCAGTACTGCCGCGGGCACTCGGATTCGTATCAGCAGGATGATGGCTACGTGCGCGGCAAAAAGTACGACTCT
GTGCGGTGCGAGTACTGGAGACGCTAG
Gene >OphauB2|248
ATGCACATTACCAAGGTTCTCGCTCTGGCCTTTGCGTCGTCGGCACTGGCAGCCGACACTGCCGCTAGCTATCTT
GTACAAAGCCTTGTTTGGGTACAATGGAAAAAGAGAGTCGAGTCTAACGTGTGGGTGTTAGGGCATCGCATACAG
CCAGCCGCAGTACCGCGGATACTCGCAAACCATTGGCAACCACGAAGCCGGCCGCTGCGTCAATCTTGATCGCGG
CGTGTAAGTCTTGTCCAACCAAGATTCTAGATTAAGAGATGCTAATGTTGTGTAGACGCAACGATGTCGAGTCTG
TGCGTGTGTCTCGAGGTGTTCGCTGCACGTACTGGAAGTAAGTTTTGAAAAAAAAGAAGAAGGCGTCAAGAAATG
TGAGGCTAAAAGGATTGGGAAATAGTGATCAGTACTGCCGCGGGCACTCGGATTCGTATCAGCAGGATGATGGCT
ACGTGCGCGGCAAAAAGTACGACTCTGTGCGGTGCGAGTACTGGAGACGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail