Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2468
Gene name
LocationContig_18:1102..5235
Strand+
Gene length (bp)4133
Transcript length (bp)3909
Coding sequence length (bp)3909
Protein length (aa) 1303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 3.8E-42 931 1102
PF00122 E1-E2_ATPase E1-E2 ATPase 3.7E-31 269 477
PF13246 Cation_ATPase Cation transport ATPase (P-type) 2.3E-21 580 670
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 6.5E-11 740 859
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.4E-06 173 214
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 1.7E-04 831 892

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 31 1108 0.0E+00
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 173 1113 0.0E+00
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 173 1105 0.0E+00
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 174 1105 0.0E+00
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 131 1105 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 31 1108 0.0E+00
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 173 1113 0.0E+00
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 173 1105 0.0E+00
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 174 1105 0.0E+00
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 131 1105 0.0E+00
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 174 1105 0.0E+00
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 169 1105 1.0E-178
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 151 1105 2.0E-176
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 174 1105 2.0E-174
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 174 1105 3.0E-173
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 171 1105 3.0E-173
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 146 1105 2.0E-172
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 174 1105 2.0E-172
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 172 1105 3.0E-169
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 174 1105 2.0E-168
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 174 1091 6.0E-168
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 174 1105 7.0E-168
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 174 1105 6.0E-167
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 174 1105 8.0E-167
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 171 1084 7.0E-166
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 174 1091 4.0E-163
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 168 1105 1.0E-161
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 174 1105 4.0E-160
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 174 1118 5.0E-148
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 174 1105 7.0E-147
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 388 1105 1.0E-145
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 388 1105 3.0E-141
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 388 1105 4.0E-141
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 388 1105 2.0E-140
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 388 1105 5.0E-140
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 388 1105 6.0E-140
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 388 1105 2.0E-139
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 388 1106 4.0E-139
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 388 1105 2.0E-135
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 173 1102 2.0E-96
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 174 1079 3.0E-92
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 179 1068 3.0E-91
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 173 1096 2.0E-90
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 173 1068 4.0E-89
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 168 1088 2.0E-87
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 173 1005 2.0E-86
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 172 1080 4.0E-86
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 168 1084 1.0E-82
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 168 1084 7.0E-82
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 172 1084 1.0E-81
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 174 997 1.0E-81
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 172 1084 1.0E-80
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 174 1077 1.0E-79
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 174 1077 4.0E-79
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 173 1085 4.0E-79
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 173 1085 4.0E-79
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 174 1077 5.0E-79
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 174 1077 2.0E-78
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 174 1084 4.0E-78
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 173 1077 1.0E-77
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 175 1084 3.0E-76
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 178 1107 8.0E-76
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 173 1104 8.0E-76
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 155 1084 4.0E-75
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 178 1084 5.0E-75
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 174 1120 5.0E-75
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 191 986 2.0E-74
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 191 986 2.0E-74
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 191 986 3.0E-74
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 174 1077 4.0E-74
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 191 986 4.0E-74
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 235 1006 4.0E-74
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 191 986 4.0E-74
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 191 986 7.0E-74
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 174 1077 2.0E-73
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 191 986 3.0E-73
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 231 1079 6.0E-73
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 157 1102 1.0E-72
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 191 986 1.0E-72
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 274 998 3.0E-72
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 191 986 5.0E-72
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 191 986 5.0E-72
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 191 1012 1.0E-71
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 191 986 2.0E-71
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 191 986 2.0E-71
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 270 970 2.0E-71
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 196 986 2.0E-71
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 238 986 4.0E-71
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 274 986 5.0E-71
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 191 986 5.0E-71
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 191 986 6.0E-71
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 191 986 7.0E-71
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 191 986 1.0E-70
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 178 976 1.0E-70
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 178 1093 2.0E-70
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 173 1046 3.0E-70
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 178 1084 3.0E-70
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 235 986 5.0E-70
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 236 976 5.0E-70
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 191 986 6.0E-70
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 191 986 7.0E-70
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 209 1015 8.0E-70
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 191 986 9.0E-70
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 191 986 9.0E-70
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 174 1096 1.0E-69
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 174 1096 1.0E-69
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 174 1096 1.0E-69
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 225 982 1.0E-69
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 168 976 1.0E-69
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 209 1015 2.0E-69
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 225 982 2.0E-69
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 191 986 2.0E-69
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 191 986 2.0E-69
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 225 982 3.0E-69
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 191 986 3.0E-69
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 168 976 3.0E-69
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 235 988 4.0E-69
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 238 971 5.0E-69
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 168 976 6.0E-69
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 191 986 8.0E-69
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 178 976 9.0E-69
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 225 982 1.0E-68
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 168 976 1.0E-68
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 191 986 1.0E-68
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 196 986 2.0E-68
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 270 982 2.0E-68
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 178 976 2.0E-68
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 191 986 3.0E-68
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 178 976 5.0E-68
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 225 982 7.0E-68
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 178 976 8.0E-68
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 178 976 8.0E-68
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 175 976 8.0E-68
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 178 976 9.0E-68
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 191 986 1.0E-67
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 178 976 1.0E-67
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 168 976 1.0E-67
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 244 986 6.0E-67
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 228 985 9.0E-66
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 196 986 3.0E-65
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 238 986 1.0E-62
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 171 991 6.0E-56
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 174 991 1.0E-55
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 174 991 4.0E-55
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 630 1102 4.0E-48
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 273 954 4.0E-45
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 597 967 5.0E-35
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 600 963 6.0E-34
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 151 373 2.0E-32
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 175 913 9.0E-32
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 175 913 9.0E-32
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 628 961 2.0E-31
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 628 961 4.0E-31
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 169 373 5.0E-30
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 169 373 7.0E-30
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 174 373 4.0E-29
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 172 513 1.0E-28
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 130 913 7.0E-27
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 130 913 7.0E-27
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 173 503 9.0E-27
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 172 513 1.0E-26
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 168 373 1.0E-25
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 168 373 1.0E-25
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 168 373 2.0E-25
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 168 373 3.0E-25
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 168 373 3.0E-25
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 617 914 1.0E-22
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 621 998 1.0E-22
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 621 914 2.0E-22
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 621 946 3.0E-22
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 195 877 3.0E-22
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 621 914 1.0E-21
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 195 877 1.0E-21
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 621 914 1.0E-21
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 621 914 2.0E-21
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 621 914 4.0E-21
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 617 914 6.0E-21
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 621 1096 2.0E-20
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 621 1067 2.0E-20
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 617 914 2.0E-20
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 621 1005 2.0E-20
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 621 914 5.0E-20
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 624 1020 6.0E-20
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 621 1005 8.0E-20
sp|P23980|PMA2_SOLLC Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 621 914 1.0E-19
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 448 984 2.0E-19
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 448 1002 2.0E-19
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 621 1005 2.0E-19
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 621 1005 3.0E-19
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 733 918 9.0E-17
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 279 513 1.0E-16
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 279 513 2.0E-16
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 456 908 2.0E-16
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 739 911 3.0E-16
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 739 911 3.0E-16
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 739 911 3.0E-16
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 237 1019 3.0E-16
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 174 522 4.0E-16
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 741 896 8.0E-16
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 172 943 4.0E-15
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 172 512 5.0E-15
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 743 898 8.0E-15
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 219 1008 9.0E-15
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 741 913 1.0E-14
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 742 896 1.0E-14
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 742 919 1.0E-14
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 633 992 2.0E-14
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 688 896 2.0E-14
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 688 896 2.0E-14
sp|P19815|SPC1D_EMENI Conidium-specific protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=SpoC1-C1D PE=2 SV=2 37 98 3.0E-14
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 743 918 3.0E-14
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 741 913 3.0E-14
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 740 918 5.0E-14
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 629 921 5.0E-14
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 743 896 5.0E-14
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 740 918 6.0E-14
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 481 875 1.0E-13
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 740 913 1.0E-13
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 741 916 1.0E-13
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 209 512 1.0E-13
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 743 896 1.0E-13
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 743 896 1.0E-13
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 743 896 1.0E-13
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 743 896 2.0E-13
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 743 896 2.0E-13
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 744 919 2.0E-13
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 733 912 2.0E-13
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 743 896 2.0E-13
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 743 896 2.0E-13
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 743 896 2.0E-13
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 743 896 2.0E-13
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 741 984 2.0E-13
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 743 896 2.0E-13
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 740 918 2.0E-13
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 735 896 2.0E-13
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 740 918 2.0E-13
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 740 918 2.0E-13
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 209 512 2.0E-13
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 744 919 2.0E-13
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 734 914 2.0E-13
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 633 992 2.0E-13
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 743 919 2.0E-13
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 742 919 2.0E-13
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 491 984 5.0E-13
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 744 915 5.0E-13
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 622 978 5.0E-13
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 741 896 6.0E-13
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 622 978 6.0E-13
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 741 898 6.0E-13
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 602 911 8.0E-13
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 743 938 8.0E-13
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 180 512 1.0E-12
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 742 916 1.0E-12
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 742 916 1.0E-12
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 176 520 2.0E-12
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 176 520 2.0E-12
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 744 915 2.0E-12
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 741 892 2.0E-12
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 741 918 2.0E-12
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 740 913 2.0E-12
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 740 913 2.0E-12
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 740 913 2.0E-12
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 741 896 3.0E-12
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 741 896 4.0E-12
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 743 896 4.0E-12
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 741 896 5.0E-12
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 173 512 5.0E-12
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 679 919 6.0E-12
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 629 973 7.0E-12
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 744 915 8.0E-12
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 738 896 8.0E-12
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 441 985 8.0E-12
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 741 896 9.0E-12
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 741 892 1.0E-11
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 441 985 1.0E-11
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 209 512 1.0E-11
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 742 918 1.0E-11
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 735 896 1.0E-11
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 629 914 2.0E-11
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 237 793 2.0E-11
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 199 876 2.0E-11
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 741 896 2.0E-11
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 741 892 3.0E-11
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 723 896 4.0E-11
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 179 512 5.0E-11
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 743 896 5.0E-11
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 743 896 5.0E-11
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 738 957 6.0E-11
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 771 943 6.0E-11
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 771 943 6.0E-11
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 771 943 6.0E-11
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 399 806 7.0E-11
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 743 916 7.0E-11
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 743 916 7.0E-11
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 743 896 7.0E-11
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 730 896 8.0E-11
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 730 896 8.0E-11
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 730 896 8.0E-11
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 730 896 8.0E-11
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 730 896 8.0E-11
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 699 896 1.0E-10
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 743 918 1.0E-10
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 743 918 1.0E-10
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 441 855 1.0E-10
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 237 877 1.0E-10
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 740 956 1.0E-10
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 740 956 1.0E-10
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 235 790 2.0E-10
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 441 918 2.0E-10
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 743 896 2.0E-10
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 275 512 3.0E-10
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 634 914 3.0E-10
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 743 936 3.0E-10
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 456 876 3.0E-10
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 741 896 3.0E-10
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 741 896 3.0E-10
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 741 896 3.0E-10
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 741 896 3.0E-10
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 742 896 3.0E-10
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 741 896 4.0E-10
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 741 896 4.0E-10
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 741 896 4.0E-10
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 741 896 4.0E-10
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 741 896 4.0E-10
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 489 980 4.0E-10
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 740 956 4.0E-10
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 738 896 4.0E-10
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 235 879 6.0E-10
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 634 914 8.0E-10
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 274 512 1.0E-09
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 274 512 1.0E-09
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 274 512 1.0E-09
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 629 914 1.0E-09
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 208 512 1.0E-09
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 291 512 2.0E-09
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 274 512 2.0E-09
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 634 914 2.0E-09
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 174 512 2.0E-09
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 743 904 2.0E-09
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 741 951 2.0E-09
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 272 794 2.0E-09
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 735 896 2.0E-09
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 273 512 2.0E-09
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 771 956 3.0E-09
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 235 817 4.0E-09
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 634 914 6.0E-09
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 712 896 6.0E-09
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 735 896 7.0E-09
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 489 789 8.0E-09
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 743 916 9.0E-09
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 786 967 9.0E-09
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 735 896 9.0E-09
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 489 790 9.0E-09
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 291 512 1.0E-08
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 735 896 1.0E-08
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 743 884 1.0E-08
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 174 512 2.0E-08
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 621 914 2.0E-08
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 742 896 2.0E-08
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 741 946 2.0E-08
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 741 946 2.0E-08
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 741 946 2.0E-08
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 735 896 2.0E-08
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 735 896 2.0E-08
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 735 896 2.0E-08
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 276 512 3.0E-08
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 291 512 3.0E-08
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 624 914 3.0E-08
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 820 896 3.0E-08
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 456 876 3.0E-08
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 735 896 3.0E-08
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 741 912 3.0E-08
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 714 892 3.0E-08
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 742 951 3.0E-08
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 735 914 3.0E-08
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 735 896 4.0E-08
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 735 896 4.0E-08
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 735 896 4.0E-08
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 763 885 4.0E-08
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 734 891 4.0E-08
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 738 896 4.0E-08
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 734 891 4.0E-08
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 735 896 4.0E-08
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 700 898 4.0E-08
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 742 896 4.0E-08
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 291 512 5.0E-08
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 738 896 5.0E-08
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 825 916 5.0E-08
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 274 512 6.0E-08
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 825 916 6.0E-08
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 825 916 6.0E-08
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 489 967 6.0E-08
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 489 790 6.0E-08
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 444 876 6.0E-08
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 743 905 7.0E-08
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 441 876 7.0E-08
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 260 512 9.0E-08
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 274 512 1.0E-07
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 274 512 1.0E-07
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 252 514 1.0E-07
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 741 881 1.0E-07
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 456 870 1.0E-07
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 444 876 1.0E-07
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 260 512 1.0E-07
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 820 896 1.0E-07
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 260 512 1.0E-07
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 260 512 1.0E-07
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 274 512 2.0E-07
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 173 510 2.0E-07
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 820 896 2.0E-07
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 610 896 2.0E-07
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 610 896 2.0E-07
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 789 1004 2.0E-07
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 742 918 2.0E-07
sp|B9DFX7|HMA8_ARATH Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 738 914 2.0E-07
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 735 896 2.0E-07
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 291 512 3.0E-07
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 274 512 3.0E-07
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 286 512 3.0E-07
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 286 512 3.0E-07
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 286 512 3.0E-07
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 742 896 3.0E-07
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 274 509 4.0E-07
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 735 896 4.0E-07
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 735 896 4.0E-07
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 173 512 5.0E-07
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 291 512 5.0E-07
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 274 512 6.0E-07
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 277 509 6.0E-07
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 716 951 6.0E-07
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 167 506 7.0E-07
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 260 512 7.0E-07
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 260 512 7.0E-07
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 771 907 8.0E-07
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 741 896 8.0E-07
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 292 506 9.0E-07
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 260 512 9.0E-07
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 771 907 1.0E-06
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 771 907 1.0E-06
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 771 907 1.0E-06
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 820 959 1.0E-06
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 629 789 1.0E-06
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 291 512 2.0E-06
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 227 507 2.0E-06
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 771 907 2.0E-06
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 771 907 2.0E-06
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 771 907 2.0E-06
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 742 896 2.0E-06
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 742 896 2.0E-06
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 741 902 3.0E-06
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 820 896 3.0E-06
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 820 896 3.0E-06
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 270 509 4.0E-06
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 820 896 4.0E-06
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 820 896 4.0E-06
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 820 896 4.0E-06
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 820 896 4.0E-06
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 820 896 4.0E-06
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 820 896 4.0E-06
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 274 509 5.0E-06
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 172 374 5.0E-06
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 489 879 6.0E-06
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 270 539 7.0E-06
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 270 509 8.0E-06
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 270 509 8.0E-06
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 270 509 8.0E-06
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 270 509 8.0E-06
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 270 509 8.0E-06
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 191 512 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 203 225 22
2 230 252 22
3 399 421 22
4 449 471 22
5 905 927 22
6 932 954 22
7 974 996 22
8 1011 1030 19
9 1051 1068 17
10 1083 1105 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2468
MAHNTLAPDGLIEPVAAPPRPRRPWLEEFRDDGPPPDNSFAFTPWQLHRLLTVRTLAALDAFGGLRGLAAGLRTD
AAAGLSADETSLDGTVSFEEAVAAGRQGRRATVQPLGETVSSSLPAAASPSSPPPLPRAAPPPAAAQTSCVSASA
SASASVQHALRMVSDAPTPSFIDRRRIFGSNLLPRRHHKSFFRLMWAAFNDKLLILLSITAFISLTIGLYQTFTA
EGGSIEWVDGVTVVAAVIVIILASAANDWQQNHKFEKLNERKDQRDVTVFRSGKACRVLINNVLVGDVLHIEAGE
VIAVDGVLISASGLHIDESPVSGEQQLVHKTVPSDHDALHAPLADPFILSGTTVIRGVGRYLVTAVGSNSTHGRT
LMSLREDVPETPLQAKLARLGKQLIMFGAIVGSIFFVLLFIWFLVDLSRPGSDLSKQSSTGKAEVFFDYLMISIA
LVIITVPEGLALNATIALAFATKRMLRDNNLVRRIRSCEIMGNATCICSDKTGTLTQNKMTVVAGCIGLEGYFDD
VYSLPPLPSSAGPSGTSARSSTESVSQVRVKRPDTSARLAASLSPDVKLLIKDSIALNSTAFESDEKVATSDFFG
SSTEMALLKFSRDHLGMGLLREERANSVIVNTLPFDSSRKWMATLIKLSDGRYRLLVKGAAELVFEYCAFAIGDV
TYELTSERLEEEDRTNVRECIRDYAERSLRPVAIACRDLEASDVFESPDDDPATVNLDWLTSGLTFVGLLGICDP
LRPEVVDSVRICQNAGVFVRMVTGDNFVTAKAVAAECGIYTAGGIAMDGPTFRRLLPAQLDEVIPRLQVLARSSP
EDKLLLVTHLRSMRETVAVTGDGTNDALALRAADVGFAMGVQGTEVAKEAASIILLDDNFASIVKALGWGRTVND
AVKKFCQFEFTINITAGIVTIVSTLAGDGDSIFSVVQLLWINLIMDIFASLGLATDQPSAEFLKRKPEPRNSPII
SITMWKMILGQAIYQLAVVLSVHYSGWKTNGPQSRVRLQTFVFNIYVWMQFFNQYNCRRIDNKLDLFFQNPLRNP
WFLGVQLVTVAGQVIIVFKGGKAFETEPLSGEQWGWSMLFGVSTIVAGLVIRCIPDVYAAWLFHLVWRILGHVSM
PLRRPWRALVACKSRLVSKCRCRAKPQDVALALADDTAAHADLKGALTQSQREVVGSAASDYTDAAVADKRIDLR
QLVDAARAGQPTPGDVLEVHPQTSATDPVLLRRACAARGDKAVPPSQDVAVLCWFKRQPQVAQRRGRLRTLAEWV
EPARSRRKTLGKIRGVTVEDFLRSKRR*
Coding >OphauB2|2468
ATGGCGCACAATACTTTGGCGCCCGACGGCCTCATTGAGCCCGTTGCGGCGCCACCTCGGCCGCGCAGGCCATGG
CTTGAAGAGTTTCGAGACGATGGGCCGCCTCCGGATAATAGCTTTGCGTTTACCCCGTGGCAGCTGCACCGGCTG
CTGACGGTTCGCACTCTGGCGGCTCTCGATGCCTTTGGCGGCTTGCGCGGACTGGCGGCTGGGTTGCGGACCGAT
GCTGCTGCTGGACTGAGCGCCGACGAAACAAGCCTTGACGGCACCGTTTCCTTTGAAGAGGCTGTTGCGGCTGGT
CGCCAGGGTCGGCGAGCTACCGTGCAGCCTCTGGGAGAGACTGTGTCGTCGAGTTTGCCAGCAGCAGCATCACCA
TCATCGCCGCCGCCTCTGCCTCGTGCTGCTCCTCCCCCGGCTGCAGCACAAACATCATGTGTTTCCGCCTCGGCT
TCGGCTTCGGCTTCGGTGCAGCACGCGCTCCGTATGGTGAGCGACGCGCCAACGCCCAGCTTCATTGACCGCCGA
CGCATCTTTGGCTCCAATCTTCTCCCCCGCCGCCACCACAAGTCGTTTTTCCGCCTCATGTGGGCCGCCTTTAAC
GACAAACTGTTGATTTTGCTGTCGATTACAGCCTTCATCTCCCTCACCATTGGCCTCTATCAAACGTTTACGGCC
GAGGGAGGCAGCATAGAATGGGTCGACGGCGTCACGGTGGTTGCTGCCGTGATTGTTATCATCTTGGCCAGCGCT
GCCAATGACTGGCAGCAGAACCACAAGTTTGAGAAGCTCAATGAGCGCAAGGACCAGCGCGACGTGACAGTCTTT
CGCTCAGGCAAGGCTTGTCGCGTCTTGATCAATAATGTCCTTGTGGGTGACGTGCTGCATATTGAGGCTGGCGAG
GTGATTGCCGTCGACGGCGTCCTCATTAGCGCCTCGGGGCTGCATATTGATGAGTCGCCTGTTTCGGGAGAGCAG
CAGCTCGTCCACAAGACTGTGCCTTCAGACCACGATGCCCTGCACGCGCCGCTCGCCGATCCCTTTATCCTTAGC
GGCACCACGGTTATCCGCGGCGTCGGACGCTACCTGGTGACTGCCGTGGGCTCCAACTCGACCCACGGACGAACC
CTCATGTCGCTGCGCGAAGACGTGCCCGAGACGCCCCTCCAGGCAAAGCTTGCTCGCCTCGGCAAGCAGCTCATC
ATGTTTGGGGCCATTGTCGGGTCCATCTTTTTTGTCCTGCTCTTTATTTGGTTTCTTGTTGACCTCTCGAGGCCT
GGCAGCGACTTGTCCAAGCAGTCGTCGACGGGCAAGGCCGAGGTTTTCTTTGACTATCTCATGATTTCGATAGCT
CTCGTCATCATCACCGTTCCAGAGGGCCTTGCTCTCAATGCCACCATTGCCCTTGCCTTTGCCACGAAGCGCATG
CTCCGGGACAACAATTTAGTGCGCCGCATCCGCTCCTGCGAGATTATGGGCAACGCCACGTGCATTTGCTCCGAC
AAGACGGGCACCCTGACGCAGAACAAGATGACTGTTGTTGCCGGCTGCATTGGCCTCGAAGGCTACTTTGACGAT
GTTTACTCGCTTCCGCCGCTCCCGTCTTCAGCTGGCCCATCCGGCACCTCTGCGAGATCGAGCACGGAATCAGTC
TCTCAAGTGCGCGTCAAGAGGCCAGACACTTCTGCCCGGCTGGCCGCGTCGCTCTCTCCAGACGTCAAGCTCCTC
ATCAAGGACAGCATCGCCCTCAACTCGACGGCCTTTGAGAGCGACGAAAAGGTGGCGACGTCGGACTTTTTTGGC
TCCAGCACCGAGATGGCGCTGCTAAAGTTTAGCCGCGACCACTTGGGAATGGGCCTTTTGCGCGAGGAGAGGGCC
AATAGCGTCATTGTGAATACGCTGCCCTTTGATTCATCGCGCAAGTGGATGGCTACCCTGATTAAGCTCAGCGAC
GGGAGATACCGTTTGCTGGTCAAGGGTGCTGCTGAGCTGGTGTTTGAGTATTGCGCCTTTGCCATTGGCGACGTG
ACTTATGAGCTCACGTCTGAGCGCCTCGAGGAGGAGGATCGGACCAATGTGCGCGAGTGTATCCGCGACTATGCC
GAGCGGTCTCTGCGGCCCGTGGCCATTGCCTGCCGCGACCTGGAAGCCTCTGACGTGTTTGAGAGTCCCGACGAC
GACCCAGCAACCGTCAACCTCGACTGGCTCACCTCTGGCCTCACCTTTGTGGGCCTGCTGGGCATTTGCGATCCC
CTGCGGCCCGAGGTTGTGGACTCGGTGCGCATCTGCCAGAATGCAGGCGTCTTTGTGCGCATGGTGACTGGCGAC
AATTTTGTGACGGCCAAGGCTGTCGCTGCGGAATGCGGGATATACACTGCTGGCGGCATCGCCATGGACGGCCCG
ACGTTTAGGAGGCTATTGCCGGCGCAGCTCGACGAGGTGATTCCGCGGCTGCAAGTGTTGGCGCGGTCGAGCCCC
GAGGATAAGCTGCTGCTGGTGACGCACTTGCGGAGCATGAGGGAGACGGTGGCGGTGACGGGGGATGGGACAAAT
GATGCGCTGGCGCTGAGGGCGGCGGATGTGGGCTTTGCCATGGGCGTTCAGGGCACAGAGGTGGCCAAGGAGGCG
GCCTCTATTATCCTGCTTGACGACAATTTTGCGTCGATTGTCAAGGCGCTGGGCTGGGGCCGTACGGTGAATGAC
GCGGTCAAGAAGTTTTGCCAGTTTGAATTCACAATCAACATTACAGCCGGCATCGTCACCATTGTCTCGACGCTT
GCTGGCGACGGCGACTCCATCTTTTCCGTGGTGCAACTGCTCTGGATCAATCTCATCATGGACATTTTTGCCTCG
CTCGGCCTGGCCACGGACCAGCCCTCGGCCGAGTTTCTCAAGCGCAAGCCGGAGCCGCGCAACTCGCCCATCATC
AGCATCACCATGTGGAAGATGATTTTGGGCCAGGCGATTTACCAGCTTGCCGTGGTGCTGTCTGTTCACTATAGC
GGATGGAAGACGAATGGGCCGCAGAGCAGGGTGCGTCTGCAGACGTTTGTCTTCAACATTTATGTGTGGATGCAA
TTCTTCAACCAGTACAACTGCCGCCGCATCGACAACAAGCTGGATTTGTTTTTCCAGAATCCGCTGCGCAACCCC
TGGTTCTTGGGGGTGCAGCTGGTTACAGTGGCGGGACAAGTCATCATCGTCTTCAAGGGCGGCAAGGCGTTTGAG
ACGGAGCCGCTGTCGGGCGAGCAGTGGGGCTGGAGCATGCTGTTTGGCGTGTCCACCATTGTGGCAGGCTTGGTG
ATTCGGTGCATTCCCGATGTCTACGCCGCCTGGCTCTTCCACCTTGTCTGGCGCATTCTTGGGCACGTCAGCATG
CCGCTGCGCCGGCCGTGGCGAGCCCTCGTTGCGTGCAAGTCGCGACTGGTGTCGAAATGCCGTTGCCGCGCAAAG
CCCCAAGACGTGGCCCTGGCGCTCGCCGACGACACTGCCGCCCACGCCGACCTCAAGGGCGCCTTGACGCAGTCA
CAGCGCGAAGTGGTGGGCTCGGCTGCCAGCGACTATACCGACGCTGCAGTGGCGGACAAGAGAATCGACCTGCGC
CAGCTTGTCGATGCGGCGCGCGCAGGACAGCCCACGCCAGGCGACGTGCTAGAAGTGCATCCGCAGACGAGCGCA
ACGGACCCGGTGCTGCTGCGTCGTGCTTGTGCTGCGCGCGGCGACAAGGCGGTGCCGCCCAGTCAGGATGTGGCG
GTGCTGTGCTGGTTCAAGAGACAGCCTCAGGTGGCGCAGCGACGCGGCAGGCTGCGCACCCTTGCAGAGTGGGTT
GAGCCGGCGCGCTCGCGGCGCAAGACGTTGGGCAAGATTCGCGGCGTCACGGTGGAAGATTTTCTCAGGTCCAAG
AGGCGCTGA
Transcript >OphauB2|2468
ATGGCGCACAATACTTTGGCGCCCGACGGCCTCATTGAGCCCGTTGCGGCGCCACCTCGGCCGCGCAGGCCATGG
CTTGAAGAGTTTCGAGACGATGGGCCGCCTCCGGATAATAGCTTTGCGTTTACCCCGTGGCAGCTGCACCGGCTG
CTGACGGTTCGCACTCTGGCGGCTCTCGATGCCTTTGGCGGCTTGCGCGGACTGGCGGCTGGGTTGCGGACCGAT
GCTGCTGCTGGACTGAGCGCCGACGAAACAAGCCTTGACGGCACCGTTTCCTTTGAAGAGGCTGTTGCGGCTGGT
CGCCAGGGTCGGCGAGCTACCGTGCAGCCTCTGGGAGAGACTGTGTCGTCGAGTTTGCCAGCAGCAGCATCACCA
TCATCGCCGCCGCCTCTGCCTCGTGCTGCTCCTCCCCCGGCTGCAGCACAAACATCATGTGTTTCCGCCTCGGCT
TCGGCTTCGGCTTCGGTGCAGCACGCGCTCCGTATGGTGAGCGACGCGCCAACGCCCAGCTTCATTGACCGCCGA
CGCATCTTTGGCTCCAATCTTCTCCCCCGCCGCCACCACAAGTCGTTTTTCCGCCTCATGTGGGCCGCCTTTAAC
GACAAACTGTTGATTTTGCTGTCGATTACAGCCTTCATCTCCCTCACCATTGGCCTCTATCAAACGTTTACGGCC
GAGGGAGGCAGCATAGAATGGGTCGACGGCGTCACGGTGGTTGCTGCCGTGATTGTTATCATCTTGGCCAGCGCT
GCCAATGACTGGCAGCAGAACCACAAGTTTGAGAAGCTCAATGAGCGCAAGGACCAGCGCGACGTGACAGTCTTT
CGCTCAGGCAAGGCTTGTCGCGTCTTGATCAATAATGTCCTTGTGGGTGACGTGCTGCATATTGAGGCTGGCGAG
GTGATTGCCGTCGACGGCGTCCTCATTAGCGCCTCGGGGCTGCATATTGATGAGTCGCCTGTTTCGGGAGAGCAG
CAGCTCGTCCACAAGACTGTGCCTTCAGACCACGATGCCCTGCACGCGCCGCTCGCCGATCCCTTTATCCTTAGC
GGCACCACGGTTATCCGCGGCGTCGGACGCTACCTGGTGACTGCCGTGGGCTCCAACTCGACCCACGGACGAACC
CTCATGTCGCTGCGCGAAGACGTGCCCGAGACGCCCCTCCAGGCAAAGCTTGCTCGCCTCGGCAAGCAGCTCATC
ATGTTTGGGGCCATTGTCGGGTCCATCTTTTTTGTCCTGCTCTTTATTTGGTTTCTTGTTGACCTCTCGAGGCCT
GGCAGCGACTTGTCCAAGCAGTCGTCGACGGGCAAGGCCGAGGTTTTCTTTGACTATCTCATGATTTCGATAGCT
CTCGTCATCATCACCGTTCCAGAGGGCCTTGCTCTCAATGCCACCATTGCCCTTGCCTTTGCCACGAAGCGCATG
CTCCGGGACAACAATTTAGTGCGCCGCATCCGCTCCTGCGAGATTATGGGCAACGCCACGTGCATTTGCTCCGAC
AAGACGGGCACCCTGACGCAGAACAAGATGACTGTTGTTGCCGGCTGCATTGGCCTCGAAGGCTACTTTGACGAT
GTTTACTCGCTTCCGCCGCTCCCGTCTTCAGCTGGCCCATCCGGCACCTCTGCGAGATCGAGCACGGAATCAGTC
TCTCAAGTGCGCGTCAAGAGGCCAGACACTTCTGCCCGGCTGGCCGCGTCGCTCTCTCCAGACGTCAAGCTCCTC
ATCAAGGACAGCATCGCCCTCAACTCGACGGCCTTTGAGAGCGACGAAAAGGTGGCGACGTCGGACTTTTTTGGC
TCCAGCACCGAGATGGCGCTGCTAAAGTTTAGCCGCGACCACTTGGGAATGGGCCTTTTGCGCGAGGAGAGGGCC
AATAGCGTCATTGTGAATACGCTGCCCTTTGATTCATCGCGCAAGTGGATGGCTACCCTGATTAAGCTCAGCGAC
GGGAGATACCGTTTGCTGGTCAAGGGTGCTGCTGAGCTGGTGTTTGAGTATTGCGCCTTTGCCATTGGCGACGTG
ACTTATGAGCTCACGTCTGAGCGCCTCGAGGAGGAGGATCGGACCAATGTGCGCGAGTGTATCCGCGACTATGCC
GAGCGGTCTCTGCGGCCCGTGGCCATTGCCTGCCGCGACCTGGAAGCCTCTGACGTGTTTGAGAGTCCCGACGAC
GACCCAGCAACCGTCAACCTCGACTGGCTCACCTCTGGCCTCACCTTTGTGGGCCTGCTGGGCATTTGCGATCCC
CTGCGGCCCGAGGTTGTGGACTCGGTGCGCATCTGCCAGAATGCAGGCGTCTTTGTGCGCATGGTGACTGGCGAC
AATTTTGTGACGGCCAAGGCTGTCGCTGCGGAATGCGGGATATACACTGCTGGCGGCATCGCCATGGACGGCCCG
ACGTTTAGGAGGCTATTGCCGGCGCAGCTCGACGAGGTGATTCCGCGGCTGCAAGTGTTGGCGCGGTCGAGCCCC
GAGGATAAGCTGCTGCTGGTGACGCACTTGCGGAGCATGAGGGAGACGGTGGCGGTGACGGGGGATGGGACAAAT
GATGCGCTGGCGCTGAGGGCGGCGGATGTGGGCTTTGCCATGGGCGTTCAGGGCACAGAGGTGGCCAAGGAGGCG
GCCTCTATTATCCTGCTTGACGACAATTTTGCGTCGATTGTCAAGGCGCTGGGCTGGGGCCGTACGGTGAATGAC
GCGGTCAAGAAGTTTTGCCAGTTTGAATTCACAATCAACATTACAGCCGGCATCGTCACCATTGTCTCGACGCTT
GCTGGCGACGGCGACTCCATCTTTTCCGTGGTGCAACTGCTCTGGATCAATCTCATCATGGACATTTTTGCCTCG
CTCGGCCTGGCCACGGACCAGCCCTCGGCCGAGTTTCTCAAGCGCAAGCCGGAGCCGCGCAACTCGCCCATCATC
AGCATCACCATGTGGAAGATGATTTTGGGCCAGGCGATTTACCAGCTTGCCGTGGTGCTGTCTGTTCACTATAGC
GGATGGAAGACGAATGGGCCGCAGAGCAGGGTGCGTCTGCAGACGTTTGTCTTCAACATTTATGTGTGGATGCAA
TTCTTCAACCAGTACAACTGCCGCCGCATCGACAACAAGCTGGATTTGTTTTTCCAGAATCCGCTGCGCAACCCC
TGGTTCTTGGGGGTGCAGCTGGTTACAGTGGCGGGACAAGTCATCATCGTCTTCAAGGGCGGCAAGGCGTTTGAG
ACGGAGCCGCTGTCGGGCGAGCAGTGGGGCTGGAGCATGCTGTTTGGCGTGTCCACCATTGTGGCAGGCTTGGTG
ATTCGGTGCATTCCCGATGTCTACGCCGCCTGGCTCTTCCACCTTGTCTGGCGCATTCTTGGGCACGTCAGCATG
CCGCTGCGCCGGCCGTGGCGAGCCCTCGTTGCGTGCAAGTCGCGACTGGTGTCGAAATGCCGTTGCCGCGCAAAG
CCCCAAGACGTGGCCCTGGCGCTCGCCGACGACACTGCCGCCCACGCCGACCTCAAGGGCGCCTTGACGCAGTCA
CAGCGCGAAGTGGTGGGCTCGGCTGCCAGCGACTATACCGACGCTGCAGTGGCGGACAAGAGAATCGACCTGCGC
CAGCTTGTCGATGCGGCGCGCGCAGGACAGCCCACGCCAGGCGACGTGCTAGAAGTGCATCCGCAGACGAGCGCA
ACGGACCCGGTGCTGCTGCGTCGTGCTTGTGCTGCGCGCGGCGACAAGGCGGTGCCGCCCAGTCAGGATGTGGCG
GTGCTGTGCTGGTTCAAGAGACAGCCTCAGGTGGCGCAGCGACGCGGCAGGCTGCGCACCCTTGCAGAGTGGGTT
GAGCCGGCGCGCTCGCGGCGCAAGACGTTGGGCAAGATTCGCGGCGTCACGGTGGAAGATTTTCTCAGGTCCAAG
AGGCGCTGA
Gene >OphauB2|2468
ATGGCGCACAATACTTTGGCGCCCGACGGCCTCATTGAGCCCGTTGCGGCGCCACCTCGGCCGCGCAGGCCATGG
CTTGAAGAGTTTCGAGACGATGGGCCGCCTCCGGATAATAGCTTTGCGTTTACCCCGTGGCAGCTGCACCGGCTG
CTGACGGTTCGCACTCTGGCGGCTCTCGATGCCTTTGGCGGCTTGCGCGGACTGGCGGCTGGGTTGCGGACCGAT
GCTGCTGCTGGACTGAGCGCCGACGAAACAAGCCTTGACGGCACCGTTTCCTTTGAAGAGGCTGTTGCGGCTGGT
CGCCAGGGTCGGCGAGCTACCGTGCAGCCTCTGGGAGAGACTGTGTCGTCGAGTTTGCCAGCAGCAGCATCACCA
TCATCGCCGCCGCCTCTGCCTCGTGCTGCTCCTCCCCCGGCTGCAGCACAAACATCATGTGTTTCCGCCTCGGCT
TCGGCTTCGGCTTCGGTGCAGCACGCGCTCCGTATGGTGAGCGACGCGCCAACGCCCAGCTTCATTGACCGCCGA
CGCATCTTTGGCTCCAATCTTCTCCCCCGCCGCCACCACAAGTCGTTTTTCCGCCTCATGTGGGCCGCCTTTAAC
GACAAACTGTTGATTTTGCTGTCGATTACAGCCTTCATCTCCCTCACCATTGGCCTCTATCAAACGTTTACGGCC
GAGGGAGGCAGCATAGAATGGGTCGACGGCGTCACGGTGGTTGCTGCCGTGATTGTTATCATCTTGGCCAGCGCT
GCCAATGACTGGCAGCAGAACCACAAGTTTGAGAAGCTCAATGAGCGCAAGGACCAGCGCGACGTGACAGTCTTT
CGCTCAGGCAAGGCTTGTCGCGTCTTGATCAATAATGTCCTTGTGGGTGACGTGCTGCATATTGAGGCTGGCGAG
GTGATTGCCGTCGACGGCGTCCTCATTAGCGCCTCGGGGCTGCATATTGATGAGTCGCCTGTTTCGGGAGAGCAG
CAGCTCGTCCACAAGACTGTGCCTTCAGACCACGATGCCCTGCACGCGCCGCTCGCCGATCCCTTTATCCTTAGC
GGCACCACGGTTATCCGCGGCGTCGGACGCTACCTGGTGACTGCCGTGGGCTCCAACTCGACCCACGGACGAACC
CTCATGTCGCTGCGCGAAGACGTGCCCGAGACGCCCCTCCAGGCAAAGCTTGCTCGCCTCGGCAAGCAGCTCATC
ATGTTTGGGGCCATTGTCGGGTCCATCTTTTTTGTCCTGCTCTTTATTTGGTTTCTTGTTGACCTCTCGAGGCCT
GGCAGCGACTTGTCCAAGCAGTCGTCGACGGGCAAGGCCGAGGTTTTCTTTGACTATCTCATGATTTCGATAGCT
CTCGTCATCATCACCGTTCCAGAGGGCCTTGCTCTCAATGCCACCATTGCCCTTGCCTTTGCCACGAAGCGCATG
CTCCGGGACAACAATTTAGTGCGCCGCATCCGCTCCTGCGAGATTATGGGCAACGCCACGTGCATTTGCTCCGAC
AAGACGGGCACCCTGACGCAGAACAAGATGACTGTTGTTGCCGGCTGCATTGGCCTCGAAGGCTACTTTGACGAT
GTTTACTCGCTTCCGCCGCTCCCGTCTTCAGCTGGCCCATCCGGCACCTCTGCGAGATCGAGCACGGAATCAGTC
TCTCAAGTGCGCGTCAAGAGGCCAGACACTTCTGCCCGGCTGGCCGCGTCGCTCTCTCCAGACGTCAAGCTCCTC
ATCAAGGACAGCATCGCCCTCAACTCGACGGCCTTTGAGAGCGACGAAAAGGTGGCGACGTCGGACTTTTTTGGC
TCCAGCACCGAGATGGCGCTGCTAAAGTTTAGCCGCGACCACTTGGGAATGGGCCTTTTGCGCGAGGAGAGGGCC
AATAGCGTCATTGTGAATACGCTGCCCTTTGATTCATCGCGCAAGTGGATGGCTACCCTGATTAAGCTCAGCGAC
GGGAGATACCGTTTGCTGGTCAAGGGTGCTGCTGAGCTGGTGTTTGAGTATTGCGCCTTTGCCATTGGCGACGTG
ACTTATGAGCTCACGTCTGAGCGCCTCGAGGAGGAGGATCGGACCAATGTGCGCGAGTGTATCCGCGACTATGCC
GAGCGGTCTCTGCGGCCCGTGGCCATTGCCTGCCGCGACCTGGAAGCCTCTGACGTGTTTGAGAGTCCCGACGAC
GACCCAGCAACCGTCAACCTCGACTGGCTCACCTCTGGCCTCACCTTTGTGGGCCTGCTGGGCATTTGCGATCCC
CTGCGGCCCGAGGTTGTGGACTCGGTGCGCATCTGCCAGAATGCAGGCGTCTTTGTGCGCATGGTGACTGGCGAC
AATTTTGTGACGGCCAAGGCTGTCGCTGCGGAATGCGGGATATACACTGCTGGCGGCATCGCCATGGACGGCCCG
ACGTTTAGGAGGCTATTGCCGGCGCAGCTCGACGAGGTGATTCCGCGGCTGCAAGTGTTGGCGCGGTCGAGCCCC
GAGGATAAGCTGCTGCTGGTGACGCACTTGCGGAGCATGAGGGAGACGGTGGCGGTGACGGGGGATGGGACAAAT
GATGCGCTGGCGCTGAGGGCGGCGGATGTGGGCTTTGCCATGGGCGTTCAGGGCACAGAGGTGGCCAAGGAGGCG
GCCTCTATTATCCTGCTTGACGACAATTTTGCGTCGATTGTCAAGGCGCTGGGCTGGGGCCGTACGGTGAATGAC
GCGGTCAAGAAGTTTTGCCAGGTGTGTCTCTCTTTTTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCCTTTTTTTTTCTCCTCTTTTCCT
TTTTTTTTCTCCTTCTTTTTTCCTTGTCTCCCCTTTTTGGCTCTTTTTTTTTTCCCGACGCCTAGTGACAATGTG
GTCTAACGCACTGTGGCCAGTTTGAATTCACAATCAACATTACAGCCGGCATCGTCACCATTGTCTCGACGCTTG
CTGGCGACGGCGACTCCATCTTTTCCGTGGTGCAACTGCTCTGGATCAATCTCATCATGGACATTTTTGCCTCGC
TCGGCCTGGCCACGGACCAGCCCTCGGCCGAGTTTCTCAAGCGCAAGCCGGAGCCGCGCAACTCGCCCATCATCA
GCATCACCATGTGGAAGATGATTTTGGGCCAGGCGATTTACCAGCTTGCCGTGGTGCTGTCTGTTCACTATAGCG
GATGGAAGACGAATGGGCCGCAGAGCAGGGTGCGTCTGCAGACGTTTGTCTTCAACATTTATGTGTGGATGCAAT
TCTTCAACCAGTACAACTGCCGCCGCATCGACAACAAGCTGGATTTGTTTTTCCAGAATCCGCTGCGCAACCCCT
GGTTCTTGGGGGTGCAGCTGGTTACAGTGGCGGGACAAGTCATCATCGTCTTCAAGGGCGGCAAGGCGTTTGAGA
CGGAGCCGCTGTCGGGCGAGCAGTGGGGCTGGAGCATGCTGTTTGGCGTGTCCACCATTGTGGCAGGCTTGGTGA
TTCGGTGCATTCCCGATGTCTACGCCGCCTGGCTCTTCCACCTTGTCTGGCGCATTCTTGGGCACGTCAGCATGC
CGCTGCGCCGGCCGTGGCGAGCCCTCGTTGCGTGCAAGTCGCGACTGGTGTCGAAATGCCGTTGCCGCGCAAAGC
CCCAAGACGTGGCCCTGGCGCTCGCCGACGACACTGCCGCCCACGCCGACCTCAAGGGCGCCTTGACGCAGTCAC
AGCGCGAAGTGGTGGGCTCGGCTGCCAGCGACTATACCGACGCTGCAGTGGCGGACAAGAGAATCGACCTGCGCC
AGCTTGTCGATGCGGCGCGCGCAGGACAGCCCACGCCAGGCGACGTGCTAGAAGTGCATCCGCAGACGAGCGCAA
CGGACCCGGTGCTGCTGCGTCGTGCTTGTGCTGCGCGCGGCGACAAGGCGGTGCCGCCCAGTCAGGATGTGGCGG
TGCTGTGCTGGTTCAAGAGACAGCCTCAGGTGGCGCAGCGACGCGGCAGGCTGCGCACCCTTGCAGAGTGGGTTG
AGCCGGCGCGCTCGCGGCGCAAGACGTTGGGCAAGATTCGCGGCGTCACGGTGGAAGATTTTCTCAGGTCCAAGA
GGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail