Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2462
Gene name
LocationContig_179:21910..23983
Strand+
Gene length (bp)2073
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 4.3E-10 503 555

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36166|PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXL1 PE=1 SV=3 457 544 7.0E-10
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 458 551 2.0E-07
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 500 555 3.0E-07
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 458 551 7.0E-07
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 500 562 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36166|PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXL1 PE=1 SV=3 457 544 7.0E-10
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 458 551 2.0E-07
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 500 555 3.0E-07
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 458 551 7.0E-07
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 500 562 1.0E-06
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 500 562 1.0E-06
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 491 562 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2462
MALPRESTFMPTIKCSSCGNQVEISMMGDHVCDEAGAELSPPPEFDKGYGQPLQSKFGRMPPQVDTNAANRPYMH
RGQLTPVSQPSDSRSASPVVHNGGPSPSLTDDTFATRSPAPGRRPGGYGGFSRADGDDGEADEGALGRMKDRIKG
LVPGPFDSGLRPTTSHNARQDTLPSPDELPRIMDPYRPGTSPGHDATRPVMAPPKVPRKNGYGGFGPPASALAEP
ASPSGYISRSETYPLPSPRLPSGKNHVGEDGERKRAMGPDRTRKPPPRISLLAQHRPKHASSSVDLAAEFGIGNP
YNTSVGSPSPSLSPFAGSYASPISTSTVTSPAPSQGSPESPRLQKEHKLRSPKSPRLHKENKLRKAASPRLDRYD
PAVQSGQADLPSPTMLSPRKKPGGGFMGLFRDRDRERDRERERERERELELEREREKEREKARARADPLLLPAPT
IAPAPLPYRGECKACGLAIRGKSISSADGRLTGKYHKACFVCTTCTEPFLSTDCGRGIEGQYLEDEARTKYHLGC
FRCLDCDMSLVDGYFEVDGRAYCERDAWRRSAPGLAGLPGRPGPRPAATRPPPVSGKRLGPAMGFPPRPRMNKRM
TRLGQM*
Coding >OphauB2|2462
ATGGCGCTGCCAAGGGAGTCGACCTTTATGCCAACAATAAAATGTTCATCATGCGGAAACCAGGTGGAAATCTCC
ATGATGGGAGACCACGTCTGTGACGAAGCCGGTGCTGAACTGTCACCTCCGCCAGAGTTTGACAAGGGCTACGGC
CAGCCTCTGCAATCAAAGTTTGGACGCATGCCGCCACAGGTCGACACCAATGCTGCGAACCGCCCATACATGCAC
CGCGGCCAGTTGACGCCCGTGAGCCAGCCAAGCGACTCGCGCAGCGCGTCGCCAGTAGTACACAATGGGGGACCA
TCACCCAGTCTGACCGACGACACGTTTGCGACACGATCGCCAGCACCAGGGAGACGGCCTGGAGGCTATGGCGGA
TTCAGCAGAGCTGACGGCGACGATGGCGAGGCCGACGAGGGCGCGCTGGGGAGAATGAAGGATCGCATCAAGGGT
CTGGTGCCCGGACCCTTTGACAGTGGGCTGAGACCAACCACGTCGCACAACGCACGACAAGACACCTTGCCGTCG
CCCGACGAGCTGCCGCGCATCATGGATCCCTACCGGCCAGGCACCAGCCCAGGCCATGACGCGACAAGGCCCGTC
ATGGCGCCGCCCAAGGTGCCGAGGAAAAATGGCTATGGAGGCTTCGGGCCGCCGGCGAGCGCCCTTGCCGAGCCC
GCGTCGCCGTCGGGCTACATCAGCAGGTCCGAGACGTATCCGTTGCCGTCGCCGCGGCTGCCGTCTGGCAAAAAC
CACGTGGGCGAGGATGGTGAGCGCAAAAGGGCCATGGGGCCGGACCGGACGCGCAAGCCGCCGCCTCGCATCAGC
CTGCTCGCCCAGCACCGGCCGAAGCATGCGTCGTCGTCGGTGGACCTGGCAGCCGAGTTTGGCATCGGAAATCCC
TACAACACGTCGGTTGGATCGCCATCGCCCTCGCTGTCGCCCTTTGCCGGCAGCTATGCCAGTCCCATTAGCACC
AGCACCGTGACGAGTCCAGCGCCGTCTCAGGGCAGCCCCGAGTCGCCTCGGCTGCAAAAGGAGCACAAGCTGCGC
AGCCCCAAGTCGCCTCGGCTGCACAAGGAGAACAAGCTGCGCAAGGCAGCATCGCCACGGCTGGATCGCTACGAC
CCGGCTGTGCAATCAGGCCAAGCAGACCTGCCGTCGCCCACAATGCTGTCTCCGCGCAAGAAGCCGGGAGGCGGC
TTCATGGGGCTCTTCCGGGACCGGGACCGGGAGCGGGATCGGGAGCGCGAGAGGGAGCGCGAGAGAGAGCTGGAG
CTGGAGCGCGAGCGAGAAAAAGAGCGAGAAAAAGCCAGAGCGCGCGCTGACCCGCTGCTCCTGCCAGCCCCCACT
ATCGCTCCAGCGCCACTGCCCTATCGCGGCGAGTGCAAGGCCTGCGGGCTGGCGATCCGCGGCAAGAGCATCTCG
TCGGCCGACGGGCGGCTGACGGGAAAGTACCACAAGGCATGTTTTGTCTGCACCACATGCACCGAGCCCTTTCTG
TCCACCGACTGCGGCCGCGGCATCGAGGGCCAGTATCTCGAGGACGAGGCCCGCACCAAGTACCACCTGGGCTGC
TTCCGCTGCCTCGACTGCGACATGTCGCTGGTGGACGGCTACTTTGAGGTTGATGGCCGCGCCTATTGCGAGCGC
GATGCCTGGCGGCGCTCCGCCCCTGGCCTGGCTGGTCTGCCCGGCCGTCCAGGCCCGAGGCCTGCTGCCACTCGG
CCTCCGCCCGTCTCGGGCAAAAGACTGGGGCCTGCCATGGGCTTTCCTCCTCGCCCGCGCATGAACAAGCGCATG
ACGCGGTTGGGCCAAATGTGA
Transcript >OphauB2|2462
ATGGCGCTGCCAAGGGAGTCGACCTTTATGCCAACAATAAAATGTTCATCATGCGGAAACCAGGTGGAAATCTCC
ATGATGGGAGACCACGTCTGTGACGAAGCCGGTGCTGAACTGTCACCTCCGCCAGAGTTTGACAAGGGCTACGGC
CAGCCTCTGCAATCAAAGTTTGGACGCATGCCGCCACAGGTCGACACCAATGCTGCGAACCGCCCATACATGCAC
CGCGGCCAGTTGACGCCCGTGAGCCAGCCAAGCGACTCGCGCAGCGCGTCGCCAGTAGTACACAATGGGGGACCA
TCACCCAGTCTGACCGACGACACGTTTGCGACACGATCGCCAGCACCAGGGAGACGGCCTGGAGGCTATGGCGGA
TTCAGCAGAGCTGACGGCGACGATGGCGAGGCCGACGAGGGCGCGCTGGGGAGAATGAAGGATCGCATCAAGGGT
CTGGTGCCCGGACCCTTTGACAGTGGGCTGAGACCAACCACGTCGCACAACGCACGACAAGACACCTTGCCGTCG
CCCGACGAGCTGCCGCGCATCATGGATCCCTACCGGCCAGGCACCAGCCCAGGCCATGACGCGACAAGGCCCGTC
ATGGCGCCGCCCAAGGTGCCGAGGAAAAATGGCTATGGAGGCTTCGGGCCGCCGGCGAGCGCCCTTGCCGAGCCC
GCGTCGCCGTCGGGCTACATCAGCAGGTCCGAGACGTATCCGTTGCCGTCGCCGCGGCTGCCGTCTGGCAAAAAC
CACGTGGGCGAGGATGGTGAGCGCAAAAGGGCCATGGGGCCGGACCGGACGCGCAAGCCGCCGCCTCGCATCAGC
CTGCTCGCCCAGCACCGGCCGAAGCATGCGTCGTCGTCGGTGGACCTGGCAGCCGAGTTTGGCATCGGAAATCCC
TACAACACGTCGGTTGGATCGCCATCGCCCTCGCTGTCGCCCTTTGCCGGCAGCTATGCCAGTCCCATTAGCACC
AGCACCGTGACGAGTCCAGCGCCGTCTCAGGGCAGCCCCGAGTCGCCTCGGCTGCAAAAGGAGCACAAGCTGCGC
AGCCCCAAGTCGCCTCGGCTGCACAAGGAGAACAAGCTGCGCAAGGCAGCATCGCCACGGCTGGATCGCTACGAC
CCGGCTGTGCAATCAGGCCAAGCAGACCTGCCGTCGCCCACAATGCTGTCTCCGCGCAAGAAGCCGGGAGGCGGC
TTCATGGGGCTCTTCCGGGACCGGGACCGGGAGCGGGATCGGGAGCGCGAGAGGGAGCGCGAGAGAGAGCTGGAG
CTGGAGCGCGAGCGAGAAAAAGAGCGAGAAAAAGCCAGAGCGCGCGCTGACCCGCTGCTCCTGCCAGCCCCCACT
ATCGCTCCAGCGCCACTGCCCTATCGCGGCGAGTGCAAGGCCTGCGGGCTGGCGATCCGCGGCAAGAGCATCTCG
TCGGCCGACGGGCGGCTGACGGGAAAGTACCACAAGGCATGTTTTGTCTGCACCACATGCACCGAGCCCTTTCTG
TCCACCGACTGCGGCCGCGGCATCGAGGGCCAGTATCTCGAGGACGAGGCCCGCACCAAGTACCACCTGGGCTGC
TTCCGCTGCCTCGACTGCGACATGTCGCTGGTGGACGGCTACTTTGAGGTTGATGGCCGCGCCTATTGCGAGCGC
GATGCCTGGCGGCGCTCCGCCCCTGGCCTGGCTGGTCTGCCCGGCCGTCCAGGCCCGAGGCCTGCTGCCACTCGG
CCTCCGCCCGTCTCGGGCAAAAGACTGGGGCCTGCCATGGGCTTTCCTCCTCGCCCGCGCATGAACAAGCGCATG
ACGCGGTTGGGCCAAATGTGA
Gene >OphauB2|2462
ATGGCGCTGCCAAGGGAGTCGACCTTTATGCCAACAATAAAATGTTCATCATGCGGAAACCAGGTGGAAATCTCC
ATGATGGGAGACCACGTCTGTGACGAAGCCGGTGCTGAACGTGAGGCGTCTCCCTCCATGATGCATGCCTGGTCA
TGTTTGCTAATGCCAGGAGCAGTGTCACCTCCGCCAGAGTTTGACAAGGGCTACGGCCAGCCTCTGCAATCAAAG
TTTGGACGCATGCCGCCACAGGTCGACACCAATGCTGCGAGTAAGTTGTCCCTCTCCGTGAGAGACAGGCTTCCA
ACAGCTCCAAGACCATGGGCTAAGACACTTGACATAGACCGCCCATACATGCACCGCGGCCAGTTGACGCCCGTG
AGCCAGCCAAGCGACTCGCGCAGCGCGTCGCCAGTAGTACACAATGGGGGACCATCACCCAGTCTGACCGACGAC
ACGTTTGCGACACGATCGCCAGCACCAGGGAGACGGCCTGGAGGCTATGGCGGATTCAGCAGAGCTGACGGCGAC
GATGGCGAGGCCGACGAGGGCGCGCTGGGGAGAATGAAGGATCGCATCAAGGGTCTGGTGCCCGGACCCTTTGAC
AGTGGGCTGAGACCAACCACGTCGCACAACGCACGACAAGACACCTTGCCGTCGCCCGACGAGCTGCCGCGCATC
ATGGATCCCTACCGGCCAGGCACCAGCCCAGGCCATGACGCGACAAGGCCCGTCATGGCGCCGCCCAAGGTGCCG
AGGAAAAATGGCTATGGAGGCTTCGGGCCGCCGGCGAGCGCCCTTGCCGAGCCCGCGTCGCCGTCGGGCTACATC
AGCAGGTCCGAGACGTATCCGTTGCCGTCGCCGCGGCTGCCGTCTGGCAAAAACCACGTGGGCGAGGATGGTGAG
CGCAAAAGGGCCATGGGGCCGGACCGGACGCGCAAGCCGCCGCCTCGCATCAGCCTGCTCGCCCAGCACCGGCCG
AAGCATGCGTCGTCGTCGGTGGACCTGGCAGCCGAGTTTGGCATCGGAAATCCCTACAACACGTCGGTTGGATCG
CCATCGCCCTCGCTGTCGCCCTTTGCCGGCAGCTATGCCAGTCCCATTAGCACCAGCACCGTGACGAGTCCAGCG
CCGTCTCAGGGCAGCCCCGAGTCGCCTCGGCTGCAAAAGGAGCACAAGCTGCGCAGCCCCAAGTCGCCTCGGCTG
CACAAGGAGAACAAGCTGCGCAAGGCAGCATCGCCACGGCTGGATCGCTACGACCCGGCTGTGCAATCAGGCCAA
GCAGACCTGCCGTCGCCCACAATGCTGTCTCCGCGCAAGAAGCCGGGAGGCGGCTTCATGGGGCTCTTCCGGGAC
CGGGACCGGGAGCGGGATCGGGAGCGCGAGAGGGAGCGCGAGAGAGAGCTGGAGCTGGAGCGCGAGCGAGAAAAA
GAGCGAGAAAAAGCCAGAGCGCGCGCTGACCCGCTGCTCCTGCCAGCCCCCACTATCGCTCCAGCGCCACTGCCC
TATCGCGGCGAGTGCAAGGCCTGCGGGCTGGCGATCCGCGGCAAGAGCATCTCGTCGGCCGACGGGCGGCTGACG
GGAAAGTACCACAAGGCATGTTTTGTCTGCACCACATGCACCGAGCCCTTTCTGTCCACCGAGTTCTACGTGCTG
GGCGACCATCCCTACTGCGAGCAGCACTATCACAAGCTCAACGGCAGCCTGTGCGGCAGCTGCGGCCGCGGCATC
GAGGGCCAGTATCTCGAGGACGAGGCCCGCACCAAGTACCACCTGGGCTGCTTCCGCTGCCTCGACTGCGACATG
TCGCTGGTGGACGGCTACTTTGAGGTTGATGGCCGCGCCTATTGCGAGCGCGATGCCTGGCGGCGCTCCGCCCCT
GTGCCCGGCGACTATGACGCGCCCTCGCCCCGCTCACGGCCTCCCCCCAAGGGCCTGGCTGGTCTGCCCGGCCGT
CCAGGCCCGAGGCCTGCTGCCACTCGGCCTCCGCCCGTCTCGGGCAAAAGACTGGGGCCTGCCATGGGCTTTCCT
CCTCGCCCGCGCATGAACAAGCGCATGACGCGGTTGGGCCAAATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail