Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2454
Gene name
LocationContig_178:40802..41140
Strand-
Gene length (bp)338
Transcript length (bp)264
Coding sequence length (bp)264
Protein length (aa) 88

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15786 PET117 PET assembly of cytochrome c oxidase, mitochondrial 2.8E-25 4 69

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0DJF2|PT117_MOUSE Protein PET117 homolog, mitochondrial OS=Mus musculus GN=Pet117 PE=3 SV=1 1 50 4.0E-09
sp|Q6UWS5|PT117_HUMAN Protein PET117 homolog, mitochondrial OS=Homo sapiens GN=PET117 PE=3 SV=1 1 50 4.0E-09
sp|E9QJ05|PT117_DANRE Protein PET117 homolog, mitochondrial OS=Danio rerio GN=pet117 PE=3 SV=1 1 50 1.0E-08
sp|Q02771|PT117_YEAST Protein PET117, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET117 PE=3 SV=1 1 54 1.0E-06
sp|C6Y4C1|PT117_SCHPO Protein pet117, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pet117 PE=2 SV=1 1 65 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2454
MSRASKVTLGITSLLAVSTIVFVHVQQRLEKSAMHEGVIRDMERQRVKQERQLDFDTQRALESEYRQYQTVRQSA
EDNTQQPPPAPR*
Coding >OphauB2|2454
ATGTCTCGCGCCTCCAAAGTCACCCTCGGCATCACTTCCCTCCTCGCCGTCTCGACAATCGTCTTTGTCCACGTG
CAACAAAGGCTCGAAAAATCGGCCATGCACGAGGGCGTTATACGCGACATGGAGAGGCAGCGCGTCAAGCAGGAG
CGCCAGCTCGACTTTGACACCCAACGCGCCCTCGAATCAGAGTATCGCCAATACCAAACCGTTCGCCAGTCTGCC
GAAGACAACACTCAGCAGCCCCCTCCAGCACCGAGATAG
Transcript >OphauB2|2454
ATGTCTCGCGCCTCCAAAGTCACCCTCGGCATCACTTCCCTCCTCGCCGTCTCGACAATCGTCTTTGTCCACGTG
CAACAAAGGCTCGAAAAATCGGCCATGCACGAGGGCGTTATACGCGACATGGAGAGGCAGCGCGTCAAGCAGGAG
CGCCAGCTCGACTTTGACACCCAACGCGCCCTCGAATCAGAGTATCGCCAATACCAAACCGTTCGCCAGTCTGCC
GAAGACAACACTCAGCAGCCCCCTCCAGCACCGAGATAG
Gene >OphauB2|2454
ATGTCTCGCGCCTCCAAAGTCACCCTCGGCATCACTTCCCTCCTCGCCGTCTCGACAATCGTCTTTGTCCACGTG
CAACAAAGGCTCGAAAAATCGGTACGCCTCTCTCGAAACCCCTGCTACTCTGCTCCCCCATTCCCAACCTGACTC
ACCTTTTTCCTCTCTCCAAGGCCATGCACGAGGGCGTTATACGCGACATGGAGAGGCAGCGCGTCAAGCAGGAGC
GCCAGCTCGACTTTGACACCCAACGCGCCCTCGAATCAGAGTATCGCCAATACCAAACCGTTCGCCAGTCTGCCG
AAGACAACACTCAGCAGCCCCCTCCAGCACCGAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail