Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2451
Gene name
LocationContig_178:29614..31344
Strand-
Gene length (bp)1730
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05743 UEV UEV domain 1.5E-38 25 147
PF09454 Vps23_core Vps23 core domain 3.9E-21 445 508

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99816|TS101_HUMAN Tumor susceptibility gene 101 protein OS=Homo sapiens GN=TSG101 PE=1 SV=2 15 150 4.0E-26
sp|Q6IRE4|TS101_RAT Tumor susceptibility gene 101 protein OS=Rattus norvegicus GN=Tsg101 PE=1 SV=1 1 150 2.0E-25
sp|Q61187|TS101_MOUSE Tumor susceptibility gene 101 protein OS=Mus musculus GN=Tsg101 PE=1 SV=2 1 150 2.0E-25
sp|Q66KB7|UEVLD_XENTR Ubiquitin-conjugating enzyme E2 variant 3 OS=Xenopus tropicalis GN=uevld PE=2 SV=1 3 156 9.0E-21
sp|Q9LHG8|ELC_ARATH Protein ELC OS=Arabidopsis thaliana GN=ELC PE=1 SV=1 33 147 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99816|TS101_HUMAN Tumor susceptibility gene 101 protein OS=Homo sapiens GN=TSG101 PE=1 SV=2 15 150 4.0E-26
sp|Q6IRE4|TS101_RAT Tumor susceptibility gene 101 protein OS=Rattus norvegicus GN=Tsg101 PE=1 SV=1 1 150 2.0E-25
sp|Q61187|TS101_MOUSE Tumor susceptibility gene 101 protein OS=Mus musculus GN=Tsg101 PE=1 SV=2 1 150 2.0E-25
sp|Q66KB7|UEVLD_XENTR Ubiquitin-conjugating enzyme E2 variant 3 OS=Xenopus tropicalis GN=uevld PE=2 SV=1 3 156 9.0E-21
sp|Q9LHG8|ELC_ARATH Protein ELC OS=Arabidopsis thaliana GN=ELC PE=1 SV=1 33 147 1.0E-20
sp|Q9FFY6|ELCL_ARATH Protein ELC-like OS=Arabidopsis thaliana GN=ELCL PE=1 SV=1 33 147 6.0E-19
sp|Q8IX04|UEVLD_HUMAN Ubiquitin-conjugating enzyme E2 variant 3 OS=Homo sapiens GN=UEVLD PE=1 SV=2 36 156 1.0E-17
sp|Q3U1V6|UEVLD_MOUSE Ubiquitin-conjugating enzyme E2 variant 3 OS=Mus musculus GN=Uevld PE=1 SV=1 36 171 2.0E-16
sp|Q6DBY5|UEVLD_DANRE Ubiquitin-conjugating enzyme E2 variant 3 OS=Danio rerio GN=uevld PE=2 SV=1 26 152 4.0E-15
sp|Q54LJ3|TS101_DICDI ESCRT-I complex subunit tsg101 OS=Dictyostelium discoideum GN=tsg101 PE=3 SV=1 24 131 3.0E-14
sp|P25604|STP22_YEAST Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STP22 PE=1 SV=3 7 121 1.0E-11
sp|Q99816|TS101_HUMAN Tumor susceptibility gene 101 protein OS=Homo sapiens GN=TSG101 PE=1 SV=2 380 516 3.0E-10
sp|Q6IRE4|TS101_RAT Tumor susceptibility gene 101 protein OS=Rattus norvegicus GN=Tsg101 PE=1 SV=1 380 516 4.0E-10
sp|Q61187|TS101_MOUSE Tumor susceptibility gene 101 protein OS=Mus musculus GN=Tsg101 PE=1 SV=2 380 516 4.0E-10
sp|Q54LJ3|TS101_DICDI ESCRT-I complex subunit tsg101 OS=Dictyostelium discoideum GN=tsg101 PE=3 SV=1 411 509 1.0E-06
sp|P25604|STP22_YEAST Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STP22 PE=1 SV=3 435 509 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015031 protein transport Yes
GO:0036211 protein modification process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0043170 macromolecule metabolic process No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0008104 protein localization No
GO:0006810 transport No
GO:0071704 organic substance metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2451
MPVQQHVLNWLYSVLTSEYIDVNRTYNDVARALNRFPSLSPRTDVHTFPNGSSALLLHLSGTLPVVFRGSTYRFP
VSIWVPHAYPREPPLIYVTPTESMMVRPGQHVDPQGQVYHPYLARWTDFWDKSTLEDFIAVLSDVFAKEPPVISR
QAQRQALNTQPTPTPPPVPPLPPEMVPKQPHQPQDQPHQPPPPPPKQHADAATPPAAPRSTHVTSEATLTQVAVP
SRYDSVPPLPTETNFASRPDLRFQTQVHREAEAQNLHQPSSHVPVEQQSHSIPIQPPLTQAMHGPPGYMQPQGQW
QPQESWRPGWAATPTSRPDTRVQPAPPPPNILDEPLTLEVPAEATIAPPPIPPNPEKDALLRQLGQTLASMRLSS
RQQNEASMAGLKAQRTAMQKASVALQGEMNQLMQLSQMLTSNTSILHEALHKADGVIENSRHHPEPNIDELLVAP
TVVSNQLYALVAEERALGDAIFMLGRAVEKGRISPAVFAKMTRTLAREWYLKKALVRKIAQGMGLSR*
Coding >OphauB2|2451
ATGCCCGTCCAGCAACATGTGTTGAACTGGCTCTATAGCGTCCTCACGAGCGAGTACATCGACGTGAATCGCACC
TACAATGACGTTGCACGTGCCCTGAATCGTTTCCCATCTCTTTCGCCGCGGACAGACGTACACACTTTTCCAAAT
GGCTCCAGCGCTCTGCTGCTTCATCTATCAGGAACCCTGCCCGTCGTTTTTCGAGGCAGCACCTATCGATTTCCG
GTGTCAATATGGGTGCCGCATGCCTATCCGCGCGAGCCGCCTCTTATATATGTGACGCCGACTGAATCCATGATG
GTCCGTCCGGGTCAGCACGTTGACCCTCAAGGTCAAGTCTACCACCCATATCTGGCCCGATGGACCGACTTCTGG
GATAAATCAACACTCGAAGACTTTATCGCAGTTCTCTCAGACGTTTTCGCGAAGGAACCCCCAGTCATTTCTCGA
CAGGCCCAAAGACAAGCTTTGAATACACAACCTACACCAACACCGCCTCCTGTGCCGCCGTTACCACCTGAAATG
GTCCCCAAACAGCCTCACCAACCCCAAGACCAGCCTCATCAGCCGCCTCCACCTCCACCGAAGCAGCACGCAGAC
GCTGCTACTCCCCCTGCTGCTCCACGATCAACACATGTCACATCGGAGGCGACTTTGACGCAAGTAGCAGTACCC
TCGAGATACGACTCAGTTCCTCCTCTACCTACAGAAACAAATTTCGCGAGCAGACCCGATCTTCGTTTCCAGACT
CAGGTGCATCGCGAAGCTGAAGCTCAAAATTTACACCAGCCCTCGAGCCATGTTCCAGTGGAGCAACAATCACAT
TCGATCCCGATACAACCGCCTCTGACACAGGCGATGCATGGTCCTCCAGGCTATATGCAGCCTCAAGGTCAATGG
CAACCTCAAGAAAGCTGGCGGCCTGGATGGGCTGCAACGCCAACATCGAGGCCTGATACGCGAGTTCAGCCAGCG
CCTCCACCACCAAACATTCTTGATGAGCCATTGACATTGGAAGTACCCGCAGAGGCGACGATAGCACCGCCACCC
ATTCCCCCTAACCCTGAAAAAGACGCATTACTGCGACAACTGGGGCAGACCCTAGCGTCGATGCGGCTGAGCAGC
AGACAGCAGAATGAAGCGAGCATGGCAGGGCTCAAGGCTCAGCGGACAGCAATGCAAAAGGCCTCTGTGGCTCTG
CAGGGCGAAATGAACCAGCTGATGCAGCTTTCGCAGATGCTAACCTCCAACACGAGCATCTTGCACGAAGCGCTG
CACAAGGCAGACGGTGTAATCGAGAACTCGCGTCATCATCCAGAGCCAAATATTGACGAGCTTTTGGTGGCACCG
ACGGTGGTGTCGAATCAGCTCTATGCGCTTGTGGCAGAGGAGCGGGCCTTGGGCGACGCCATTTTCATGCTGGGA
CGAGCAGTAGAGAAGGGGCGAATCTCGCCGGCAGTGTTTGCGAAAATGACGCGGACCTTGGCAAGGGAGTGGTAT
TTGAAGAAGGCATTGGTGCGCAAGATTGCGCAAGGGATGGGCCTCAGCCGATAG
Transcript >OphauB2|2451
ATGCCCGTCCAGCAACATGTGTTGAACTGGCTCTATAGCGTCCTCACGAGCGAGTACATCGACGTGAATCGCACC
TACAATGACGTTGCACGTGCCCTGAATCGTTTCCCATCTCTTTCGCCGCGGACAGACGTACACACTTTTCCAAAT
GGCTCCAGCGCTCTGCTGCTTCATCTATCAGGAACCCTGCCCGTCGTTTTTCGAGGCAGCACCTATCGATTTCCG
GTGTCAATATGGGTGCCGCATGCCTATCCGCGCGAGCCGCCTCTTATATATGTGACGCCGACTGAATCCATGATG
GTCCGTCCGGGTCAGCACGTTGACCCTCAAGGTCAAGTCTACCACCCATATCTGGCCCGATGGACCGACTTCTGG
GATAAATCAACACTCGAAGACTTTATCGCAGTTCTCTCAGACGTTTTCGCGAAGGAACCCCCAGTCATTTCTCGA
CAGGCCCAAAGACAAGCTTTGAATACACAACCTACACCAACACCGCCTCCTGTGCCGCCGTTACCACCTGAAATG
GTCCCCAAACAGCCTCACCAACCCCAAGACCAGCCTCATCAGCCGCCTCCACCTCCACCGAAGCAGCACGCAGAC
GCTGCTACTCCCCCTGCTGCTCCACGATCAACACATGTCACATCGGAGGCGACTTTGACGCAAGTAGCAGTACCC
TCGAGATACGACTCAGTTCCTCCTCTACCTACAGAAACAAATTTCGCGAGCAGACCCGATCTTCGTTTCCAGACT
CAGGTGCATCGCGAAGCTGAAGCTCAAAATTTACACCAGCCCTCGAGCCATGTTCCAGTGGAGCAACAATCACAT
TCGATCCCGATACAACCGCCTCTGACACAGGCGATGCATGGTCCTCCAGGCTATATGCAGCCTCAAGGTCAATGG
CAACCTCAAGAAAGCTGGCGGCCTGGATGGGCTGCAACGCCAACATCGAGGCCTGATACGCGAGTTCAGCCAGCG
CCTCCACCACCAAACATTCTTGATGAGCCATTGACATTGGAAGTACCCGCAGAGGCGACGATAGCACCGCCACCC
ATTCCCCCTAACCCTGAAAAAGACGCATTACTGCGACAACTGGGGCAGACCCTAGCGTCGATGCGGCTGAGCAGC
AGACAGCAGAATGAAGCGAGCATGGCAGGGCTCAAGGCTCAGCGGACAGCAATGCAAAAGGCCTCTGTGGCTCTG
CAGGGCGAAATGAACCAGCTGATGCAGCTTTCGCAGATGCTAACCTCCAACACGAGCATCTTGCACGAAGCGCTG
CACAAGGCAGACGGTGTAATCGAGAACTCGCGTCATCATCCAGAGCCAAATATTGACGAGCTTTTGGTGGCACCG
ACGGTGGTGTCGAATCAGCTCTATGCGCTTGTGGCAGAGGAGCGGGCCTTGGGCGACGCCATTTTCATGCTGGGA
CGAGCAGTAGAGAAGGGGCGAATCTCGCCGGCAGTGTTTGCGAAAATGACGCGGACCTTGGCAAGGGAGTGGTAT
TTGAAGAAGGCATTGGTGCGCAAGATTGCGCAAGGGATGGGCCTCAGCCGATAG
Gene >OphauB2|2451
ATGCCCGTCCAGCAACATGTGTTGAACTGGCTCTATAGCGTCCTCACGAGCGTACGTACACTGACATGGGATTCA
AGACTGGCGCTGACGTTGTCATGACAGGAGTACATCGACGTGAATCGCACCTACAATGACGTTGCACGTGCCCTG
AATCGTTTCCCATCTCTTTCGCCGCGGACAGACGTACACAGTAGAAATTTCCCATTGGATTGCCTGGTACGCAAT
TATGGAAGAAAGCGCTGACTTGTTGCCACAGCTTTTCCAAATGGCTCCAGCGCTCTGCTGCTTCATCTATCAGGA
ACCCTGCCCGTCGTTTTTCGAGGCAGCACCTATCGATTTCCGGTGTCAATATGGGTGCCGCATGCCTATCCGCGC
GAGCCGCCTCTTATATATGTGACGCCGACTGAATCCATGATGGTCCGTCCGGGTCAGCACGTTGACCCTCAAGGT
CAAGTCTACCACCCATATCTGGCCCGATGGACCGACTTCTGGGATGTAAGTATCGACGAGGAGAAATAGGCCCTG
TATCGAGCCGACTGCTCATCCACTTATAGAAATCAACACTCGAAGACTTTATCGCAGTTCTCTCAGACGTTTTCG
CGAAGGAACCCCCAGTCATTTCTCGACAGGCCCAAAGACAAGCTTTGAATACACAACCTACACCAACACCGCCTC
CTGTGCCGCCGTTACCACCTGAAATGGTCCCCAAACAGCCTCACCAACCCCAAGACCAGCCTCATCAGCCGCCTC
CACCTCCACCGAAGCAGCACGCAGACGCTGCTACTCCCCCTGCTGCTCCACGATCAACACATGTCACATCGGAGG
CGACTTTGACGCAAGTAGCAGTACCCTCGAGATACGACTCAGTTCCTCCTCTACCTACAGAAACAAATTTCGCGA
GCAGACCCGATCTTCGTTTCCAGACTCAGGTGCATCGCGAAGCTGAAGCTCAAAATTTACACCAGCCCTCGAGCC
ATGTTCCAGTGGAGCAACAATCACATTCGATCCCGATACAACCGCCTCTGACACAGGCGATGCATGGTCCTCCAG
GCTATATGCAGCCTCAAGGTCAATGGCAACCTCAAGAAAGCTGGCGGCCTGGATGGGCTGCAACGCCAACATCGA
GGCCTGATACGCGAGTTCAGCCAGCGCCTCCACCACCAAACATTCTTGATGAGCCATTGACATTGGAAGTACCCG
CAGAGGCGACGATAGCACCGCCACCCATTCCCCCTAACCCTGAAAAAGACGCATTACTGCGACAACTGGGGCAGA
CCCTAGCGTCGATGCGGCTGAGCAGCAGACAGCAGAATGAAGCGAGCATGGCAGGGCTCAAGGCTCAGCGGACAG
CAATGCAAAAGGCCTCTGTGGCTCTGCAGGGCGAAATGAACCAGCTGATGCAGCTTTCGCAGATGCTAACCTCCA
ACACGAGCATCTTGCACGAAGCGCTGCACAAGGCAGACGGTGTAATCGAGAACTCGCGTCATCATCCAGAGCCAA
ATATTGACGAGCTTTTGGTGGCACCGACGGTGGTGTCGAATCAGCTCTATGCGCTTGTGGCAGAGGAGCGGGCCT
TGGGCGACGCCATTTTCATGCTGGGACGAGCAGTAGAGAAGGGGCGAATCTCGCCGGCAGTGTTTGCGAAAATGA
CGCGGACCTTGGCAAGGGAGTGGTATTTGAAGAAGGCATTGGTGCGCAAGATTGCGCAAGGGATGGGCCTCAGCC
GATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail