Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2442
Gene name
LocationContig_178:2978..5406
Strand-
Gene length (bp)2428
Transcript length (bp)2211
Coding sequence length (bp)2211
Protein length (aa) 737

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01204 Trehalase Trehalase 1.2E-190 141 699
PF07492 Trehalase_Ca-bi Neutral trehalase Ca2+ binding domain 1.2E-16 84 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42783|TREB_NEUCR Neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=treB PE=2 SV=2 8 733 0.0E+00
sp|O42622|TREB_MAGO7 Neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NTH1 PE=2 SV=2 2 733 0.0E+00
sp|O42777|TREB_EMENI Neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=treB PE=3 SV=2 24 721 0.0E+00
sp|O42893|TREA_SCHPO Neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntp1 PE=1 SV=1 2 734 0.0E+00
sp|P32356|TREA_YEAST Neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTH1 PE=1 SV=3 1 721 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42783|TREB_NEUCR Neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=treB PE=2 SV=2 8 733 0.0E+00
sp|O42622|TREB_MAGO7 Neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NTH1 PE=2 SV=2 2 733 0.0E+00
sp|O42777|TREB_EMENI Neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=treB PE=3 SV=2 24 721 0.0E+00
sp|O42893|TREA_SCHPO Neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntp1 PE=1 SV=1 2 734 0.0E+00
sp|P32356|TREA_YEAST Neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTH1 PE=1 SV=3 1 721 0.0E+00
sp|Q757L1|TREB_ASHGO Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTH2 PE=3 SV=1 4 729 0.0E+00
sp|P35172|TREB_YEAST Probable trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTH2 PE=1 SV=1 7 727 0.0E+00
sp|P52494|TREA_CANAX Neutral trehalase OS=Candida albicans GN=NTC1 PE=1 SV=1 60 727 0.0E+00
sp|P49381|TREA_KLULA Neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTH1 PE=3 SV=1 61 713 0.0E+00
sp|Q9FWC1|TRE_ORYSJ Probable trehalase OS=Oryza sativa subsp. japonica GN=Os10g0521000 PE=2 SV=1 186 690 5.0E-38
sp|Q9I165|TREA_PSEAE Periplasmic trehalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=treA PE=3 SV=1 229 690 2.0E-35
sp|Q0T5J8|TREA_SHIF8 Periplasmic trehalase OS=Shigella flexneri serotype 5b (strain 8401) GN=treA PE=3 SV=1 268 727 8.0E-35
sp|B6I9Q8|TREA_ECOSE Periplasmic trehalase OS=Escherichia coli (strain SE11) GN=treA PE=3 SV=1 268 727 8.0E-35
sp|B7LXB1|TREA_ECO8A Periplasmic trehalase OS=Escherichia coli O8 (strain IAI1) GN=treA PE=3 SV=1 268 727 9.0E-35
sp|A1AAC5|TREA_ECOK1 Periplasmic trehalase OS=Escherichia coli O1:K1 / APEC GN=treA PE=3 SV=1 268 700 1.0E-34
sp|Q1RCP3|TREA_ECOUT Periplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) GN=treA PE=3 SV=1 268 700 1.0E-34
sp|B7MK99|TREA_ECO45 Periplasmic trehalase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=treA PE=3 SV=1 268 700 1.0E-34
sp|B7N408|TREA_ECOLU Periplasmic trehalase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=treA PE=3 SV=1 268 700 1.0E-34
sp|Q83RP6|TREA_SHIFL Periplasmic trehalase OS=Shigella flexneri GN=treA PE=3 SV=2 268 727 2.0E-34
sp|B7LSZ0|TREF_ESCF3 Cytoplasmic trehalase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=treF PE=3 SV=1 262 691 2.0E-34
sp|P13482|TREA_ECOLI Periplasmic trehalase OS=Escherichia coli (strain K12) GN=treA PE=1 SV=1 268 727 2.0E-34
sp|B1IU96|TREA_ECOLC Periplasmic trehalase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=treA PE=3 SV=1 268 727 2.0E-34
sp|A7ZZD1|TREA_ECOHS Periplasmic trehalase OS=Escherichia coli O9:H4 (strain HS) GN=treA PE=3 SV=1 268 727 2.0E-34
sp|B1XAN8|TREA_ECODH Periplasmic trehalase OS=Escherichia coli (strain K12 / DH10B) GN=treA PE=3 SV=1 268 727 2.0E-34
sp|C4ZTN8|TREA_ECOBW Periplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=treA PE=3 SV=1 268 727 2.0E-34
sp|B7LGV7|TREA_ECO55 Periplasmic trehalase OS=Escherichia coli (strain 55989 / EAEC) GN=treA PE=3 SV=1 268 727 2.0E-34
sp|B1LHA4|TREA_ECOSM Periplasmic trehalase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=treA PE=3 SV=1 268 700 2.0E-34
sp|Q8CW46|TREA_ECOL6 Periplasmic trehalase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=treA PE=3 SV=1 268 700 3.0E-34
sp|B7NUW3|TREA_ECO7I Periplasmic trehalase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=treA PE=3 SV=1 268 700 3.0E-34
sp|Q2NYS3|TREA_XANOM Periplasmic trehalase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=treA PE=3 SV=1 268 690 3.0E-34
sp|A7ZKW9|TREA_ECO24 Periplasmic trehalase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=treA PE=3 SV=1 268 727 3.0E-34
sp|Q8XDH7|TREA_ECO57 Putative periplasmic trehalase OS=Escherichia coli O157:H7 GN=treA PE=5 SV=2 268 700 4.0E-34
sp|Q0TIH3|TREA_ECOL5 Periplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=treA PE=3 SV=1 268 700 5.0E-34
sp|Q32H09|TREA_SHIDS Periplasmic trehalase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=treA PE=3 SV=1 268 700 5.0E-34
sp|Q1R584|TREF_ECOUT Cytoplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|Q8FCI4|TREF_ECOL6 Cytoplasmic trehalase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|Q0TBT4|TREF_ECOL5 Cytoplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|A1AH61|TREF_ECOK1 Cytoplasmic trehalase OS=Escherichia coli O1:K1 / APEC GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7MEM1|TREF_ECO45 Cytoplasmic trehalase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7UL72|TREF_ECO27 Cytoplasmic trehalase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B2U4I7|TREF_SHIB3 Cytoplasmic trehalase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B1LJ63|TREF_ECOSM Cytoplasmic trehalase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7NEG2|TREF_ECOLU Cytoplasmic trehalase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|P62601|TREF_ECOLI Cytoplasmic trehalase OS=Escherichia coli (strain K12) GN=treF PE=1 SV=1 262 691 1.0E-33
sp|B1X7X4|TREF_ECODH Cytoplasmic trehalase OS=Escherichia coli (strain K12 / DH10B) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|C4ZW66|TREF_ECOBW Cytoplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7NNF3|TREF_ECO7I Cytoplasmic trehalase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B5YVG5|TREF_ECO5E Cytoplasmic trehalase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|P62602|TREF_ECO57 Cytoplasmic trehalase OS=Escherichia coli O157:H7 GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7N1V9|TREF_ECO81 Cytoplasmic trehalase OS=Escherichia coli O81 (strain ED1a) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|Q3YWJ3|TREF_SHISS Cytoplasmic trehalase OS=Shigella sonnei (strain Ss046) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|Q83PS8|TREF_SHIFL Cytoplasmic trehalase OS=Shigella flexneri GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B6I385|TREF_ECOSE Cytoplasmic trehalase OS=Escherichia coli (strain SE11) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B1J0B4|TREF_ECOLC Cytoplasmic trehalase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|A8A5X9|TREF_ECOHS Cytoplasmic trehalase OS=Escherichia coli O9:H4 (strain HS) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7M3D0|TREF_ECO8A Cytoplasmic trehalase OS=Escherichia coli O8 (strain IAI1) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7L603|TREF_ECO55 Cytoplasmic trehalase OS=Escherichia coli (strain 55989 / EAEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|A7ZT60|TREF_ECO24 Cytoplasmic trehalase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|Q0SZB4|TREF_SHIF8 Cytoplasmic trehalase OS=Shigella flexneri serotype 5b (strain 8401) GN=treF PE=3 SV=1 262 691 1.0E-33
sp|B7UQ86|TREA_ECO27 Periplasmic trehalase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=treA PE=3 SV=1 268 700 2.0E-33
sp|Q31VA6|TREF_SHIBS Cytoplasmic trehalase OS=Shigella boydii serotype 4 (strain Sb227) GN=treF PE=3 SV=1 262 691 2.0E-33
sp|Q8Z277|TREF_SALTI Cytoplasmic trehalase OS=Salmonella typhi GN=treF PE=3 SV=1 262 691 4.0E-33
sp|Q8ZLC8|TREF_SALTY Cytoplasmic trehalase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|C0Q162|TREF_SALPC Cytoplasmic trehalase OS=Salmonella paratyphi C (strain RKS4594) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|B4SWF1|TREF_SALNS Cytoplasmic trehalase OS=Salmonella newport (strain SL254) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|B4T8D8|TREF_SALHS Cytoplasmic trehalase OS=Salmonella heidelberg (strain SL476) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|B5RGS3|TREF_SALG2 Cytoplasmic trehalase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|B5R404|TREF_SALEP Cytoplasmic trehalase OS=Salmonella enteritidis PT4 (strain P125109) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|B5FKM4|TREF_SALDC Cytoplasmic trehalase OS=Salmonella dublin (strain CT_02021853) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|Q57IL9|TREF_SALCH Cytoplasmic trehalase OS=Salmonella choleraesuis (strain SC-B67) GN=treF PE=3 SV=1 262 691 4.0E-33
sp|A8AFT6|TREA_CITK8 Periplasmic trehalase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=treA PE=3 SV=1 268 700 1.0E-32
sp|B4TZ02|TREF_SALSV Cytoplasmic trehalase OS=Salmonella schwarzengrund (strain CVM19633) GN=treF PE=3 SV=1 262 691 4.0E-32
sp|B5F9H0|TREF_SALA4 Cytoplasmic trehalase OS=Salmonella agona (strain SL483) GN=treF PE=3 SV=1 262 691 4.0E-32
sp|A9MLK7|TREF_SALAR Cytoplasmic trehalase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=treF PE=3 SV=1 262 691 5.0E-32
sp|Q8PPT1|TREA_XANAC Periplasmic trehalase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=treA PE=3 SV=1 259 690 9.0E-32
sp|B0RNH1|TREA_XANCB Periplasmic trehalase OS=Xanthomonas campestris pv. campestris (strain B100) GN=treA PE=3 SV=1 259 690 1.0E-31
sp|Q8P519|TREA_XANCP Periplasmic trehalase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=treA PE=3 SV=1 259 690 5.0E-31
sp|Q4UZ12|TREA_XANC8 Periplasmic trehalase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=treA PE=3 SV=1 259 690 5.0E-31
sp|B5BI56|TREA_SALPK Periplasmic trehalase OS=Salmonella paratyphi A (strain AKU_12601) GN=treA PE=3 SV=1 263 700 3.0E-30
sp|Q5PI73|TREA_SALPA Periplasmic trehalase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=treA PE=3 SV=1 263 700 3.0E-30
sp|B4SUI9|TREA_SALNS Periplasmic trehalase OS=Salmonella newport (strain SL254) GN=treA PE=3 SV=1 263 700 3.0E-30
sp|Q8XT38|TREA_RALSO Periplasmic trehalase OS=Ralstonia solanacearum (strain GMI1000) GN=treA PE=3 SV=1 258 705 4.0E-30
sp|B4TXW7|TREA_SALSV Periplasmic trehalase OS=Salmonella schwarzengrund (strain CVM19633) GN=treA PE=3 SV=1 263 700 5.0E-30
sp|B5F4F0|TREA_SALA4 Periplasmic trehalase OS=Salmonella agona (strain SL483) GN=treA PE=3 SV=1 269 700 1.0E-29
sp|P59765|TREA_SALTI Putative periplasmic trehalase OS=Salmonella typhi GN=treA PE=5 SV=2 263 700 2.0E-29
sp|Q9SU50|TRE1_ARATH Trehalase OS=Arabidopsis thaliana GN=TRE1 PE=2 SV=1 254 690 2.0E-29
sp|A9MVX4|TREA_SALPB Periplasmic trehalase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=treA PE=3 SV=1 263 700 3.0E-29
sp|B5R904|TREA_SALG2 Periplasmic trehalase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=treA PE=3 SV=1 263 700 4.0E-29
sp|B5R2X4|TREA_SALEP Periplasmic trehalase OS=Salmonella enteritidis PT4 (strain P125109) GN=treA PE=3 SV=1 263 700 4.0E-29
sp|B5FTN7|TREA_SALDC Periplasmic trehalase OS=Salmonella dublin (strain CT_02021853) GN=treA PE=3 SV=1 263 700 4.0E-29
sp|Q57NL6|TREA_SALCH Periplasmic trehalase OS=Salmonella choleraesuis (strain SC-B67) GN=treA PE=3 SV=1 269 700 7.0E-29
sp|C0Q337|TREA_SALPC Periplasmic trehalase OS=Salmonella paratyphi C (strain RKS4594) GN=treA PE=3 SV=1 269 700 1.0E-28
sp|Q8ZP20|TREA_SALTY Periplasmic trehalase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=treA PE=3 SV=1 269 700 3.0E-28
sp|P19813|TREA_RABIT Trehalase OS=Oryctolagus cuniculus GN=TREH PE=1 SV=1 156 691 1.0E-26
sp|P32358|TREA_BOMMO Trehalase OS=Bombyx mori PE=1 SV=1 254 691 1.0E-26
sp|Q8MMG9|TREA_PIMHY Trehalase OS=Pimpla hypochondriaca GN=tre1 PE=1 SV=1 110 691 3.0E-26
sp|A8J4S9|TREA_APIME Trehalase OS=Apis mellifera PE=1 SV=1 268 736 3.0E-25
sp|Q9JLT2|TREA_MOUSE Trehalase OS=Mus musculus GN=Treh PE=1 SV=1 159 709 1.0E-24
sp|Q9W2M2|TREA_DROME Trehalase OS=Drosophila melanogaster GN=Treh PE=1 SV=1 268 694 2.0E-24
sp|O43280|TREA_HUMAN Trehalase OS=Homo sapiens GN=TREH PE=1 SV=2 268 691 3.0E-22
sp|P32359|TREA_TENMO Trehalase OS=Tenebrio molitor PE=2 SV=1 269 691 6.0E-22
sp|Q54QZ5|TREA_DICDI Trehalase OS=Dictyostelium discoideum GN=treh PE=3 SV=1 268 698 9.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005991 trehalose metabolic process Yes
GO:0004555 alpha,alpha-trehalase activity Yes
GO:0005509 calcium ion binding Yes
GO:0005993 trehalose catabolic process Yes
GO:0005737 cytoplasm Yes
GO:0110165 cellular anatomical entity No
GO:0009311 oligosaccharide metabolic process No
GO:0005575 cellular_component No
GO:0009313 oligosaccharide catabolic process No
GO:0044275 cellular carbohydrate catabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0005975 carbohydrate metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0005984 disaccharide metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0043167 ion binding No
GO:0015927 trehalase activity No
GO:0046872 metal ion binding No
GO:0009056 catabolic process No
GO:0003824 catalytic activity No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0046352 disaccharide catabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No
GO:1901575 organic substance catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2442
MAQMADRRGRLSEDYGIYDDAKTYYASEERHTNRLGLRSRTYSQNGLYKQYDSIDPGEPFRRGSHDETTVMNARR
FLIQVDATLENLKAQEDTDGNMQITIEDNGPKVLSLRTAASAGHNRYDVRGTYMLSNLLQELTLAKEYGRKQIIL
DEGRLNENPVDRLSRLIRDHFWEGLTRRIDSSSIEIAARDPKDWTDDPRPRIYVPIGAPQQYEYYKKVAAARPEI
RLDVQLLPAEITAEVIRDMNDKPGLLAVAVEESPDGTTLQGLPFVVPGGRFNELYGWDSYMESLGLLVNERVDLA
KSMVLNFCFCIEHYGKILNATRSYYLGRSQPPFLTDMALRVYEKIKHEPDAKEFLRRSMLAAIKEYHSVWMSEPR
LDPITGLSRYRPVGKGVPPETEATHFVHILEPYIEKHKMEFGQFVRAYNHGELEEPELDEYFMHDRAVRESGHDT
TYRFEGVCANLATIDLNSLLFKYETDIARTIRSVFGDKLQVPAEFCAGTPYQAGDMLSSSAWDRRAKRRKLTVDK
FMWNEGEGMFFDYDTVKQQRCTYESSTTFWAMWAGIATPKQAAEMVRRGLPKFEAFGGLLAGTEKSRGEIGLERP
NRQWDYPYGWAPQQMLAWTGLLRYGFSEEAERLAYKWLFMITKAFVDFNGVVVEKYDVTRPVDPHRVDAEYGNQG
LDFKGVAKEGFGWVNASYVYGLQIVDAHMRRALGTLTPYPTFVKAIEQNAEKALASLTLGG*
Coding >OphauB2|2442
ATGGCGCAAATGGCAGACCGCCGTGGACGCCTGTCGGAAGACTATGGTATCTACGACGACGCAAAAACATACTAT
GCCTCTGAGGAGCGGCACACCAATCGTTTGGGATTGCGCTCCCGCACCTACTCCCAGAATGGTCTGTACAAGCAG
TACGACAGTATTGATCCAGGAGAGCCGTTTCGGCGCGGAAGCCACGATGAAACAACAGTAATGAATGCCCGACGC
TTCCTCATCCAGGTGGATGCCACGCTCGAGAACCTCAAGGCCCAGGAAGACACGGATGGCAACATGCAAATCACG
ATTGAAGACAACGGCCCCAAGGTGCTCTCTCTGCGCACTGCAGCCTCGGCCGGCCATAACCGCTACGATGTGCGC
GGCACTTACATGCTGTCGAATCTCCTCCAAGAGTTGACCTTGGCCAAGGAGTATGGGCGGAAGCAGATAATCTTG
GATGAGGGTCGTCTCAACGAAAATCCCGTGGATCGTCTTTCACGCCTGATTCGCGATCACTTCTGGGAAGGCCTG
ACGCGCCGCATCGACTCGTCGAGCATCGAAATTGCCGCTCGAGACCCCAAGGACTGGACCGACGACCCCCGTCCA
CGCATTTATGTCCCCATTGGCGCTCCTCAGCAGTACGAGTACTACAAAAAGGTGGCGGCTGCAAGACCCGAGATT
CGGCTGGATGTGCAGCTCCTCCCGGCCGAGATTACGGCTGAGGTGATTCGAGACATGAATGACAAGCCGGGTCTG
CTGGCCGTGGCTGTCGAGGAGAGTCCTGATGGCACGACGCTTCAGGGCTTGCCATTTGTTGTGCCGGGCGGCCGC
TTCAATGAGCTGTACGGCTGGGACAGCTACATGGAATCGCTGGGCCTGCTCGTCAACGAAAGAGTCGACTTGGCC
AAGTCAATGGTGCTCAACTTTTGTTTCTGCATTGAGCATTATGGCAAGATTCTCAACGCCACGAGATCCTACTAC
CTGGGCCGCTCCCAACCGCCATTTTTGACTGACATGGCACTGCGCGTGTACGAGAAGATCAAGCATGAGCCTGAC
GCCAAGGAATTCCTGAGGCGGTCGATGCTAGCGGCCATCAAGGAGTACCACAGCGTATGGATGAGCGAGCCGAGG
CTGGATCCGATAACAGGACTGTCGCGATATCGGCCCGTGGGCAAAGGCGTGCCGCCCGAGACGGAAGCAACACAC
TTTGTGCATATCCTGGAGCCCTATATTGAGAAGCACAAGATGGAGTTTGGGCAATTTGTGCGGGCTTACAATCAT
GGAGAGCTGGAGGAGCCAGAGCTGGACGAGTACTTTATGCACGACCGGGCGGTGCGCGAATCTGGGCATGACACG
ACGTACCGGTTCGAGGGCGTCTGTGCCAACCTGGCAACGATTGATCTCAACTCGCTCTTGTTCAAGTACGAGACG
GACATTGCACGCACCATTCGCAGCGTGTTTGGCGATAAGCTGCAAGTGCCAGCCGAGTTTTGCGCCGGGACGCCG
TATCAGGCAGGCGACATGCTGTCATCGTCGGCCTGGGACCGGCGGGCAAAGCGGCGCAAGCTGACGGTGGACAAG
TTTATGTGGAACGAGGGCGAGGGCATGTTTTTTGACTACGACACGGTTAAGCAGCAGCGGTGCACGTATGAAAGC
TCAACGACGTTTTGGGCCATGTGGGCAGGCATTGCCACGCCCAAGCAGGCGGCCGAGATGGTGCGGCGCGGGCTG
CCCAAGTTTGAGGCGTTTGGCGGGCTGCTGGCCGGGACTGAAAAGTCTCGAGGCGAGATTGGACTCGAGAGGCCT
AACCGGCAGTGGGACTATCCGTACGGGTGGGCGCCGCAGCAGATGCTGGCGTGGACGGGGCTGCTGCGATATGGC
TTCAGCGAGGAGGCTGAGCGGCTGGCATACAAGTGGCTGTTTATGATAACAAAGGCCTTTGTCGACTTCAACGGC
GTTGTAGTGGAAAAGTACGACGTGACGCGTCCCGTCGATCCGCATCGCGTTGATGCAGAGTATGGTAACCAGGGC
CTAGACTTCAAGGGCGTAGCCAAGGAAGGCTTTGGCTGGGTCAATGCGAGCTACGTATATGGGCTCCAGATTGTC
GATGCCCACATGCGACGAGCTCTAGGCACTCTGACGCCGTACCCGACCTTTGTCAAGGCGATTGAGCAAAATGCC
GAAAAGGCGCTGGCGAGTCTAACACTTGGGGGTTAA
Transcript >OphauB2|2442
ATGGCGCAAATGGCAGACCGCCGTGGACGCCTGTCGGAAGACTATGGTATCTACGACGACGCAAAAACATACTAT
GCCTCTGAGGAGCGGCACACCAATCGTTTGGGATTGCGCTCCCGCACCTACTCCCAGAATGGTCTGTACAAGCAG
TACGACAGTATTGATCCAGGAGAGCCGTTTCGGCGCGGAAGCCACGATGAAACAACAGTAATGAATGCCCGACGC
TTCCTCATCCAGGTGGATGCCACGCTCGAGAACCTCAAGGCCCAGGAAGACACGGATGGCAACATGCAAATCACG
ATTGAAGACAACGGCCCCAAGGTGCTCTCTCTGCGCACTGCAGCCTCGGCCGGCCATAACCGCTACGATGTGCGC
GGCACTTACATGCTGTCGAATCTCCTCCAAGAGTTGACCTTGGCCAAGGAGTATGGGCGGAAGCAGATAATCTTG
GATGAGGGTCGTCTCAACGAAAATCCCGTGGATCGTCTTTCACGCCTGATTCGCGATCACTTCTGGGAAGGCCTG
ACGCGCCGCATCGACTCGTCGAGCATCGAAATTGCCGCTCGAGACCCCAAGGACTGGACCGACGACCCCCGTCCA
CGCATTTATGTCCCCATTGGCGCTCCTCAGCAGTACGAGTACTACAAAAAGGTGGCGGCTGCAAGACCCGAGATT
CGGCTGGATGTGCAGCTCCTCCCGGCCGAGATTACGGCTGAGGTGATTCGAGACATGAATGACAAGCCGGGTCTG
CTGGCCGTGGCTGTCGAGGAGAGTCCTGATGGCACGACGCTTCAGGGCTTGCCATTTGTTGTGCCGGGCGGCCGC
TTCAATGAGCTGTACGGCTGGGACAGCTACATGGAATCGCTGGGCCTGCTCGTCAACGAAAGAGTCGACTTGGCC
AAGTCAATGGTGCTCAACTTTTGTTTCTGCATTGAGCATTATGGCAAGATTCTCAACGCCACGAGATCCTACTAC
CTGGGCCGCTCCCAACCGCCATTTTTGACTGACATGGCACTGCGCGTGTACGAGAAGATCAAGCATGAGCCTGAC
GCCAAGGAATTCCTGAGGCGGTCGATGCTAGCGGCCATCAAGGAGTACCACAGCGTATGGATGAGCGAGCCGAGG
CTGGATCCGATAACAGGACTGTCGCGATATCGGCCCGTGGGCAAAGGCGTGCCGCCCGAGACGGAAGCAACACAC
TTTGTGCATATCCTGGAGCCCTATATTGAGAAGCACAAGATGGAGTTTGGGCAATTTGTGCGGGCTTACAATCAT
GGAGAGCTGGAGGAGCCAGAGCTGGACGAGTACTTTATGCACGACCGGGCGGTGCGCGAATCTGGGCATGACACG
ACGTACCGGTTCGAGGGCGTCTGTGCCAACCTGGCAACGATTGATCTCAACTCGCTCTTGTTCAAGTACGAGACG
GACATTGCACGCACCATTCGCAGCGTGTTTGGCGATAAGCTGCAAGTGCCAGCCGAGTTTTGCGCCGGGACGCCG
TATCAGGCAGGCGACATGCTGTCATCGTCGGCCTGGGACCGGCGGGCAAAGCGGCGCAAGCTGACGGTGGACAAG
TTTATGTGGAACGAGGGCGAGGGCATGTTTTTTGACTACGACACGGTTAAGCAGCAGCGGTGCACGTATGAAAGC
TCAACGACGTTTTGGGCCATGTGGGCAGGCATTGCCACGCCCAAGCAGGCGGCCGAGATGGTGCGGCGCGGGCTG
CCCAAGTTTGAGGCGTTTGGCGGGCTGCTGGCCGGGACTGAAAAGTCTCGAGGCGAGATTGGACTCGAGAGGCCT
AACCGGCAGTGGGACTATCCGTACGGGTGGGCGCCGCAGCAGATGCTGGCGTGGACGGGGCTGCTGCGATATGGC
TTCAGCGAGGAGGCTGAGCGGCTGGCATACAAGTGGCTGTTTATGATAACAAAGGCCTTTGTCGACTTCAACGGC
GTTGTAGTGGAAAAGTACGACGTGACGCGTCCCGTCGATCCGCATCGCGTTGATGCAGAGTATGGTAACCAGGGC
CTAGACTTCAAGGGCGTAGCCAAGGAAGGCTTTGGCTGGGTCAATGCGAGCTACGTATATGGGCTCCAGATTGTC
GATGCCCACATGCGACGAGCTCTAGGCACTCTGACGCCGTACCCGACCTTTGTCAAGGCGATTGAGCAAAATGCC
GAAAAGGCGCTGGCGAGTCTAACACTTGGGGGTTAA
Gene >OphauB2|2442
ATGGCGCAAATGGCAGACCGCCGTGGACGCCTGTCGGAAGACTATGGTATCTACGACGACGCAAAAACATACTAT
GCCTCTGAGGAGCGGCACACCAATCGTTTGGGATTGCGCTCCCGCACCTACTCCCAGGTGTGTGTGCCTCTATAT
CATTGTGCGGCGAGGCTGCGGCTGGCAGCTGATCAAAGGCACAAATAGAATGGTCTGTACAAGCAGTACGACAGT
ATTGATCCAGGAGAGCCGTTTCGGCGCGGAAGCCACGGTATGCCGCAGCTCTGTAGCTGTTTCTATTTGGCAAGC
AACTGACGAGGAAGCGACGCAGATGAAACAACAGTAATGAATGCCCGACGCTTCCTCATCCAGGTGGATGCCACG
CTCGAGAACCTCAAGGCCCAGGAAGACACGGATGGCAACATGCAAATCACGATTGAAGACAACGGCCCCAAGGTG
CTCTCTCTGCGCACTGCAGCCTCGGCCGGCCATAACCGCTACGATGTGCGCGGCACTTACATGCTGTCGAATCTC
CTCCAAGAGTTGACCTTGGCCAAGGAGTATGGGCGGAAGCAGATAATCTTGGATGAGGGTCGTCTCAACGAAAAT
CCCGTGGATCGTCTTTCACGCCTGATTCGCGATCACTTCTGGGAAGGCCTGACGCGCCGCATCGACTCGTCGAGC
ATCGAAATTGCCGCTCGAGACCCCAAGGACTGGACCGACGACCCCCGTCCACGCATTTATGTCCCCATTGGCGCT
CCTCAGCAGTACGAGTACTACAAAAAGGTGGCGGCTGCAAGACCCGAGATTCGGCTGGATGTGCAGCTCCTCCCG
GCCGAGATTACGGCTGAGGTGATTCGAGACATGAATGACAAGCCGGGTCTGCTGGCCGTGGCTGTCGAGGAGAGT
CCTGATGGCACGACGCTTCAGGGCTTGCCATTTGTTGTGCCGGGCGGCCGCTTCAATGAGCTGTACGGCTGGGAC
AGCTACATGGAATCGCTGGGCCTGCTCGTCAACGAAAGAGTCGACTTGGCCAAGTCAATGGTGCTCAACTTTTGT
TTCTGCATTGAGCATTATGGCAAGATTCTCAACGCCACGAGATCCTACTACCTGGGCCGCTCCCAACCGCCATTT
TTGACTGACATGGCACTGCGCGTGTACGAGAAGATCAAGCATGAGCCTGACGCCAAGGAATTCCTGAGGCGGTCG
ATGCTAGCGGCCATCAAGGAGTACCACAGCGTATGGATGAGCGAGCCGAGGCTGGATCCGATAACAGGACTGTCG
CGATATCGGCCCGTGGGCAAAGGCGTGCCGCCCGAGACGGAAGCAACACACTTTGTGCATATCCTGGAGCCCTAT
ATTGAGAAGCACAAGATGGAGTTTGGGCAATTTGTGCGGGCTTACAATCATGGAGAGCTGGAGGAGCCAGAGCTG
GACGAGTACTTTATGCACGACCGGGCGGTGCGCGAATCTGGGCATGACACGACGTACCGGTTCGAGGGCGTCTGT
GCCAACCTGGCAACGATTGATCTCAACTCGCTCTTGTTCAAGTACGAGACGGACATTGCACGCACCATTCGCAGC
GTGTTTGGCGATAAGCTGCAAGTGCCAGCCGAGTTTTGCGCCGGGACGCCGTATCAGGCAGGCGACATGCTGTCA
TCGTCGGCCTGGGACCGGCGGGCAAAGCGGCGCAAGCTGACGGTGGACAAGTTTATGTGGAACGAGGGCGAGGGC
ATGTTTTTTGACTACGACACGGTTAAGCAGCAGCGGTGCACGTATGAAAGCTCAACGACGTTTTGGGCCATGTGG
GCAGGCATTGCCACGCCCAAGCAGGCGGCCGAGATGGTGCGGCGCGGGCTGCCCAAGTTTGAGGCGTTTGGCGGG
CTGCTGGCCGGGACTGAAAAGTCTCGAGGCGAGATTGGACTCGAGAGGCCTAACCGGCAGTGGGACTATCCGTAC
GGGTGGGCGCCGCAGCAGATGCTGGCGTGGACGGGGCTGCTGCGATATGGCTTCAGCGAGGAGGCTGAGCGGCTG
GCATACAAGTGGCTGTTTATGATAACAAAGGCCTTTGTCGACTTCAACGGCGTTGTAGTGGAAAAGTACGACGTG
ACGCGTCCCGTCGATCCGCATCGCGTTGATGCAGAGTATGGTAACCAGGGCCTAGACTTCAAGGGCGTAGCCAAG
GAAGGGTGAGTTTTTTTGTTTTTTGTTTTGAGCTTGCACGCGTATCCCACAAGGCCGAGGCTCGGATGCTGACCC
AATGGACCTTGTGGCCGACAGCTTTGGCTGGGTCAATGCGAGCTACGTATATGGGCTCCAGATTGTCGATGCCCA
CATGCGACGAGCTCTAGGCACTCTGACGCCGTACCCGACCTTTGTCAAGGCGATTGAGCAAAATGCCGAAAAGGC
GCTGGCGAGTCTAACACTTGGGGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail