Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2435
Gene name
LocationContig_177:28708..31163
Strand-
Gene length (bp)2455
Transcript length (bp)2355
Coding sequence length (bp)2355
Protein length (aa) 785

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 9.6E-17 38 115
PF01822 WSC WSC domain 2.4E-17 142 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 272 4.0E-21
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 38 238 8.0E-21
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 55 230 3.0E-19
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 38 230 2.0E-17
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 38 235 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 272 4.0E-21
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 38 238 8.0E-21
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 55 230 3.0E-19
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 38 230 2.0E-17
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 38 235 3.0E-14
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 38 230 5.0E-14
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 123 266 2.0E-13
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 38 230 6.0E-13
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 142 257 1.0E-12
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 128 261 4.0E-11
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 142 257 1.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 38 193 2.0E-09
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 137 230 2.0E-09
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 141 230 7.0E-09
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 130 230 8.0E-09
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 38 193 1.0E-08
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 38 193 1.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 141 230 3.0E-08
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 38 194 3.0E-08
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 264 433 7.0E-08
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 143 260 1.0E-07
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 38 123 4.0E-07
sp|Q9H321|VCX3B_HUMAN Variable charge X-linked protein 3B OS=Homo sapiens GN=VCX3B PE=2 SV=4 270 390 6.0E-07
sp|Q9H321|VCX3B_HUMAN Variable charge X-linked protein 3B OS=Homo sapiens GN=VCX3B PE=2 SV=4 270 376 9.0E-07
sp|Q40339|NO12B_MEDSA Early nodulin-12B OS=Medicago sativa GN=ENOD12B PE=2 SV=1 293 370 1.0E-06
sp|P30365|NO12_MEDTR Early nodulin-12 OS=Medicago truncatula GN=ENOD12 PE=2 SV=1 302 370 2.0E-06
sp|Q924S4|KREM1_RAT Kremen protein 1 OS=Rattus norvegicus GN=Kremen1 PE=2 SV=1 59 165 4.0E-06
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 59 165 9.0E-06
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 59 165 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2435
MRSAWSVAAAMALAMPALAWNVEMPPCLDKFKPFVKSGCFANGEQSAALVYRSSLDQGSMTVEKCVAECKGNGFR
YAGLKYYGVCFCGATVNGPQVDDAKCSFACSGNKTETCGGDSTLSIWQDPTFAKGPNDVSIDAYKALGCFTDQSA
KGRTLSWAAAVDAATLTTSKCLAACEKQGFPFAGTEYGGECWCGVVLANDTAKVGDEECGVACRGDARASCGGAS
RLSLYVARELESLEPCGFEATTTTAKGAYPYPTRGTLLPSSASLPISQSSSASYPASQSTLPSSASLPVSQPSSA
SYPVHQPSSASLPVSQPSSASLPVSQPSSVSYPVHQPSSASLPISQPSSTSYPVHQPSSASLPVSQSPPASLPIS
QSPSISISVPLASSSSPSSSAAANTPSSYNSSPASTASSSKPAAASSSSTNKATPTTLQSSLVAPTTPPTSASPS
TTPHGSLSSSAALCTSTTTVPAPCEWQIGNWCAPALPDWTNQDECIVAAKTCALQVVSCFRHAGWPSSIDCFDFG
RWCGNLQQHCYGSDCSGGYGGRCSGKKTCWDRYAPPGHGNPPAVSTSVHPCASSASSTRAAATPTLPPSCPPLPT
NICTQPSNDALGYGPGNPVGNIPLPIVGCNDLRDDYNSYPFKYYSEPDSSRCPSFAWRQWPDVCVDACTEQFDQC
RDTYVQSCRRPATKRSVSRRAARQAEGVSRRGAVSLWSGVSSLYGGGVCAATADDYAWSNPGADAANCWGWGGNT
PAQADKRCRSQYTDCLRINKRVDAEGMCQSYCSN*
Coding >OphauB2|2435
ATGAGGAGTGCGTGGAGCGTTGCGGCGGCCATGGCGCTGGCCATGCCGGCTCTGGCGTGGAACGTGGAGATGCCG
CCGTGTCTGGACAAGTTTAAGCCCTTTGTCAAGTCGGGGTGCTTTGCAAACGGGGAGCAGTCAGCGGCACTGGTG
TATCGGTCGAGTCTGGACCAGGGCAGCATGACGGTGGAAAAGTGTGTGGCCGAGTGCAAGGGCAATGGCTTCCGA
TATGCCGGACTCAAGTACTATGGCGTCTGCTTCTGCGGCGCCACCGTCAACGGGCCGCAGGTGGACGACGCCAAA
TGCTCCTTTGCCTGCAGCGGCAACAAGACGGAGACGTGTGGCGGCGACTCGACCCTCTCGATATGGCAGGACCCC
ACCTTTGCCAAGGGCCCCAACGACGTGAGCATCGACGCGTACAAGGCGCTGGGCTGCTTCACCGACCAGTCGGCA
AAGGGCCGCACGCTGTCGTGGGCGGCGGCAGTCGACGCGGCGACGCTGACTACGAGCAAGTGTCTGGCGGCGTGC
GAGAAGCAGGGCTTTCCCTTTGCGGGGACAGAGTATGGCGGGGAGTGCTGGTGCGGTGTCGTGCTGGCGAATGAT
ACGGCAAAGGTGGGTGATGAAGAGTGTGGTGTGGCCTGTCGGGGGGATGCGAGGGCCAGCTGTGGAGGGGCGTCG
CGGTTGAGTTTGTATGTGGCCAGGGAGCTTGAGTCGTTGGAGCCGTGTGGCTTTGAGGCGACGACGACGACGGCA
AAGGGGGCGTATCCGTATCCGACACGTGGGACTCTGCTGCCATCGTCGGCCAGTCTGCCCATCTCTCAGTCGTCG
TCTGCCAGCTATCCCGCCTCTCAGTCGACTCTGCCATCATCTGCCAGCTTGCCCGTCTCTCAACCATCATCTGCC
AGCTATCCGGTACATCAGCCGTCGTCTGCCAGTCTGCCAGTCTCTCAGCCATCATCGGCCAGCTTGCCCGTTTCT
CAGCCATCGTCTGTCAGCTATCCCGTCCACCAACCGTCGTCTGCCAGCTTGCCCATCTCTCAACCATCATCTACC
AGCTATCCCGTCCACCAGCCATCGTCTGCCAGCCTGCCCGTCTCGCAGTCGCCTCCTGCTAGCCTGCCAATCTCT
CAGTCGCCCTCCATCAGCATCTCTGTCCCGCTTGCTTCCTCTTCTTCGCCCTCGAGCTCAGCAGCAGCAAACACT
CCATCCTCATACAACAGCTCCCCCGCATCAACGGCCAGCTCCTCCAAGCCAGCAGCCGCCTCGTCGTCTTCCACC
AACAAGGCCACGCCTACAACGCTGCAAAGCTCCCTCGTCGCTCCAACAACGCCCCCAACCTCTGCCTCGCCATCC
ACCACGCCTCACGGCTCCCTCTCCTCCTCGGCCGCCCTCTGCACCTCCACCACAACGGTGCCGGCGCCCTGCGAG
TGGCAGATTGGCAACTGGTGCGCTCCGGCGCTTCCAGACTGGACAAACCAGGACGAGTGCATCGTCGCGGCCAAG
ACGTGCGCGCTGCAAGTCGTCTCGTGCTTCCGCCACGCTGGTTGGCCGAGCAGCATCGACTGCTTCGACTTTGGG
CGCTGGTGCGGCAACCTACAGCAACACTGCTACGGCAGCGACTGTAGCGGCGGCTATGGCGGGCGCTGCAGCGGC
AAGAAGACGTGCTGGGACCGCTATGCGCCGCCTGGCCATGGCAATCCACCAGCTGTATCCACGTCGGTCCATCCA
TGCGCGTCGAGTGCTTCGTCGACTCGCGCTGCTGCCACGCCAACGCTGCCGCCGTCGTGCCCTCCGCTGCCGACA
AATATCTGCACACAGCCGTCGAATGATGCGCTCGGCTACGGCCCTGGGAACCCCGTGGGCAACATTCCGCTGCCC
ATTGTCGGCTGCAACGACTTGCGCGACGACTACAACAGCTATCCCTTCAAGTACTACTCGGAGCCCGACAGTTCG
CGATGCCCATCCTTTGCCTGGCGCCAGTGGCCCGATGTCTGCGTCGATGCCTGCACCGAGCAGTTTGACCAGTGC
CGCGACACCTATGTCCAGAGCTGCCGCCGCCCAGCCACCAAGAGGAGCGTCTCGAGGCGTGCTGCGCGACAGGCA
GAAGGCGTGTCCAGGCGCGGCGCCGTGTCGCTGTGGTCGGGCGTCTCGTCGCTCTATGGAGGCGGCGTCTGTGCT
GCCACGGCAGACGACTATGCGTGGAGCAATCCAGGTGCTGATGCCGCCAATTGCTGGGGCTGGGGAGGTAATACG
CCTGCCCAGGCGGATAAGAGGTGCCGCAGTCAGTACACCGACTGTCTGCGCATCAACAAGCGCGTCGATGCAGAG
GGCATGTGCCAGTCCTACTGCAGCAATTAG
Transcript >OphauB2|2435
ATGAGGAGTGCGTGGAGCGTTGCGGCGGCCATGGCGCTGGCCATGCCGGCTCTGGCGTGGAACGTGGAGATGCCG
CCGTGTCTGGACAAGTTTAAGCCCTTTGTCAAGTCGGGGTGCTTTGCAAACGGGGAGCAGTCAGCGGCACTGGTG
TATCGGTCGAGTCTGGACCAGGGCAGCATGACGGTGGAAAAGTGTGTGGCCGAGTGCAAGGGCAATGGCTTCCGA
TATGCCGGACTCAAGTACTATGGCGTCTGCTTCTGCGGCGCCACCGTCAACGGGCCGCAGGTGGACGACGCCAAA
TGCTCCTTTGCCTGCAGCGGCAACAAGACGGAGACGTGTGGCGGCGACTCGACCCTCTCGATATGGCAGGACCCC
ACCTTTGCCAAGGGCCCCAACGACGTGAGCATCGACGCGTACAAGGCGCTGGGCTGCTTCACCGACCAGTCGGCA
AAGGGCCGCACGCTGTCGTGGGCGGCGGCAGTCGACGCGGCGACGCTGACTACGAGCAAGTGTCTGGCGGCGTGC
GAGAAGCAGGGCTTTCCCTTTGCGGGGACAGAGTATGGCGGGGAGTGCTGGTGCGGTGTCGTGCTGGCGAATGAT
ACGGCAAAGGTGGGTGATGAAGAGTGTGGTGTGGCCTGTCGGGGGGATGCGAGGGCCAGCTGTGGAGGGGCGTCG
CGGTTGAGTTTGTATGTGGCCAGGGAGCTTGAGTCGTTGGAGCCGTGTGGCTTTGAGGCGACGACGACGACGGCA
AAGGGGGCGTATCCGTATCCGACACGTGGGACTCTGCTGCCATCGTCGGCCAGTCTGCCCATCTCTCAGTCGTCG
TCTGCCAGCTATCCCGCCTCTCAGTCGACTCTGCCATCATCTGCCAGCTTGCCCGTCTCTCAACCATCATCTGCC
AGCTATCCGGTACATCAGCCGTCGTCTGCCAGTCTGCCAGTCTCTCAGCCATCATCGGCCAGCTTGCCCGTTTCT
CAGCCATCGTCTGTCAGCTATCCCGTCCACCAACCGTCGTCTGCCAGCTTGCCCATCTCTCAACCATCATCTACC
AGCTATCCCGTCCACCAGCCATCGTCTGCCAGCCTGCCCGTCTCGCAGTCGCCTCCTGCTAGCCTGCCAATCTCT
CAGTCGCCCTCCATCAGCATCTCTGTCCCGCTTGCTTCCTCTTCTTCGCCCTCGAGCTCAGCAGCAGCAAACACT
CCATCCTCATACAACAGCTCCCCCGCATCAACGGCCAGCTCCTCCAAGCCAGCAGCCGCCTCGTCGTCTTCCACC
AACAAGGCCACGCCTACAACGCTGCAAAGCTCCCTCGTCGCTCCAACAACGCCCCCAACCTCTGCCTCGCCATCC
ACCACGCCTCACGGCTCCCTCTCCTCCTCGGCCGCCCTCTGCACCTCCACCACAACGGTGCCGGCGCCCTGCGAG
TGGCAGATTGGCAACTGGTGCGCTCCGGCGCTTCCAGACTGGACAAACCAGGACGAGTGCATCGTCGCGGCCAAG
ACGTGCGCGCTGCAAGTCGTCTCGTGCTTCCGCCACGCTGGTTGGCCGAGCAGCATCGACTGCTTCGACTTTGGG
CGCTGGTGCGGCAACCTACAGCAACACTGCTACGGCAGCGACTGTAGCGGCGGCTATGGCGGGCGCTGCAGCGGC
AAGAAGACGTGCTGGGACCGCTATGCGCCGCCTGGCCATGGCAATCCACCAGCTGTATCCACGTCGGTCCATCCA
TGCGCGTCGAGTGCTTCGTCGACTCGCGCTGCTGCCACGCCAACGCTGCCGCCGTCGTGCCCTCCGCTGCCGACA
AATATCTGCACACAGCCGTCGAATGATGCGCTCGGCTACGGCCCTGGGAACCCCGTGGGCAACATTCCGCTGCCC
ATTGTCGGCTGCAACGACTTGCGCGACGACTACAACAGCTATCCCTTCAAGTACTACTCGGAGCCCGACAGTTCG
CGATGCCCATCCTTTGCCTGGCGCCAGTGGCCCGATGTCTGCGTCGATGCCTGCACCGAGCAGTTTGACCAGTGC
CGCGACACCTATGTCCAGAGCTGCCGCCGCCCAGCCACCAAGAGGAGCGTCTCGAGGCGTGCTGCGCGACAGGCA
GAAGGCGTGTCCAGGCGCGGCGCCGTGTCGCTGTGGTCGGGCGTCTCGTCGCTCTATGGAGGCGGCGTCTGTGCT
GCCACGGCAGACGACTATGCGTGGAGCAATCCAGGTGCTGATGCCGCCAATTGCTGGGGCTGGGGAGGTAATACG
CCTGCCCAGGCGGATAAGAGGTGCCGCAGTCAGTACACCGACTGTCTGCGCATCAACAAGCGCGTCGATGCAGAG
GGCATGTGCCAGTCCTACTGCAGCAATTAG
Gene >OphauB2|2435
ATGAGGAGTGCGTGGAGCGTTGCGGCGGCCATGGCGCTGGCCATGCCGGCTCTGGCGTGGAACGTGGAGATGCCG
CCGTGTCTGGACAAGTTTAAGCCCTTTGTCAAGTCGGGGTGCTTTGCAAACGGGGAGCAGTCAGCGGCACTGGTG
TATCGGTCGAGTCTGGACCAGGGCAGCATGACGGTGGAAAAGTGTGTGGCCGAGTGCAAGGGTGAGTAAGGAGGG
GCGCCATGTCAATGACCTCGAGGCTTGACTCGCCATCAAGAGACGAGTCTCGAGATAAAGAGACGGAGGCTAATT
CGACAAACCAGGCAATGGCTTCCGATATGCCGGACTCAAGTACTATGGCGTCTGCTTCTGCGGCGCCACCGTCAA
CGGGCCGCAGGTGGACGACGCCAAATGCTCCTTTGCCTGCAGCGGCAACAAGACGGAGACGTGTGGCGGCGACTC
GACCCTCTCGATATGGCAGGACCCCACCTTTGCCAAGGGCCCCAACGACGTGAGCATCGACGCGTACAAGGCGCT
GGGCTGCTTCACCGACCAGTCGGCAAAGGGCCGCACGCTGTCGTGGGCGGCGGCAGTCGACGCGGCGACGCTGAC
TACGAGCAAGTGTCTGGCGGCGTGCGAGAAGCAGGGCTTTCCCTTTGCGGGGACAGAGTATGGCGGGGAGTGCTG
GTGCGGTGTCGTGCTGGCGAATGATACGGCAAAGGTGGGTGATGAAGAGTGTGGTGTGGCCTGTCGGGGGGATGC
GAGGGCCAGCTGTGGAGGGGCGTCGCGGTTGAGTTTGTATGTGGCCAGGGAGCTTGAGTCGTTGGAGCCGTGTGG
CTTTGAGGCGACGACGACGACGGCAAAGGGGGCGTATCCGTATCCGACACGTGGGACTCTGCTGCCATCGTCGGC
CAGTCTGCCCATCTCTCAGTCGTCGTCTGCCAGCTATCCCGCCTCTCAGTCGACTCTGCCATCATCTGCCAGCTT
GCCCGTCTCTCAACCATCATCTGCCAGCTATCCGGTACATCAGCCGTCGTCTGCCAGTCTGCCAGTCTCTCAGCC
ATCATCGGCCAGCTTGCCCGTTTCTCAGCCATCGTCTGTCAGCTATCCCGTCCACCAACCGTCGTCTGCCAGCTT
GCCCATCTCTCAACCATCATCTACCAGCTATCCCGTCCACCAGCCATCGTCTGCCAGCCTGCCCGTCTCGCAGTC
GCCTCCTGCTAGCCTGCCAATCTCTCAGTCGCCCTCCATCAGCATCTCTGTCCCGCTTGCTTCCTCTTCTTCGCC
CTCGAGCTCAGCAGCAGCAAACACTCCATCCTCATACAACAGCTCCCCCGCATCAACGGCCAGCTCCTCCAAGCC
AGCAGCCGCCTCGTCGTCTTCCACCAACAAGGCCACGCCTACAACGCTGCAAAGCTCCCTCGTCGCTCCAACAAC
GCCCCCAACCTCTGCCTCGCCATCCACCACGCCTCACGGCTCCCTCTCCTCCTCGGCCGCCCTCTGCACCTCCAC
CACAACGGTGCCGGCGCCCTGCGAGTGGCAGATTGGCAACTGGTGCGCTCCGGCGCTTCCAGACTGGACAAACCA
GGACGAGTGCATCGTCGCGGCCAAGACGTGCGCGCTGCAAGTCGTCTCGTGCTTCCGCCACGCTGGTTGGCCGAG
CAGCATCGACTGCTTCGACTTTGGGCGCTGGTGCGGCAACCTACAGCAACACTGCTACGGCAGCGACTGTAGCGG
CGGCTATGGCGGGCGCTGCAGCGGCAAGAAGACGTGCTGGGACCGCTATGCGCCGCCTGGCCATGGCAATCCACC
AGCTGTATCCACGTCGGTCCATCCATGCGCGTCGAGTGCTTCGTCGACTCGCGCTGCTGCCACGCCAACGCTGCC
GCCGTCGTGCCCTCCGCTGCCGACAAATATCTGCACACAGCCGTCGAATGATGCGCTCGGCTACGGCCCTGGGAA
CCCCGTGGGCAACATTCCGCTGCCCATTGTCGGCTGCAACGACTTGCGCGACGACTACAACAGCTATCCCTTCAA
GTACTACTCGGAGCCCGACAGTTCGCGATGCCCATCCTTTGCCTGGCGCCAGTGGCCCGATGTCTGCGTCGATGC
CTGCACCGAGCAGTTTGACCAGTGCCGCGACACCTATGTCCAGAGCTGCCGCCGCCCAGCCACCAAGAGGAGCGT
CTCGAGGCGTGCTGCGCGACAGGCAGAAGGCGTGTCCAGGCGCGGCGCCGTGTCGCTGTGGTCGGGCGTCTCGTC
GCTCTATGGAGGCGGCGTCTGTGCTGCCACGGCAGACGACTATGCGTGGAGCAATCCAGGTGCTGATGCCGCCAA
TTGCTGGGGCTGGGGAGGTAATACGCCTGCCCAGGCGGATAAGAGGTGCCGCAGTCAGTACACCGACTGTCTGCG
CATCAACAAGCGCGTCGATGCAGAGGGCATGTGCCAGTCCTACTGCAGCAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail