Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2434
Gene name
LocationContig_177:27041..28111
Strand-
Gene length (bp)1070
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 1.3E-14 161 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7F0Q2|POED2_ORYSJ Polyprenol reductase 2 OS=Oryza sativa subsp. japonica GN=Os07g0493400 PE=2 SV=1 77 314 6.0E-16
sp|B8B6G5|POED2_ORYSI Polyprenol reductase 2 OS=Oryza sativa subsp. indica GN=OsI_26070 PE=3 SV=2 77 314 7.0E-16
sp|Q7XUH5|POED1_ORYSJ Polyprenol reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0576800 PE=2 SV=2 77 314 3.0E-15
sp|A2XWN6|POED1_ORYSI Polyprenol reductase 1 OS=Oryza sativa subsp. indica GN=OsI_17065 PE=3 SV=1 77 314 3.0E-15
sp|Q0P4J9|PORED_XENTR Polyprenol reductase OS=Xenopus tropicalis GN=srd5a3 PE=2 SV=1 132 315 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7F0Q2|POED2_ORYSJ Polyprenol reductase 2 OS=Oryza sativa subsp. japonica GN=Os07g0493400 PE=2 SV=1 77 314 6.0E-16
sp|B8B6G5|POED2_ORYSI Polyprenol reductase 2 OS=Oryza sativa subsp. indica GN=OsI_26070 PE=3 SV=2 77 314 7.0E-16
sp|Q7XUH5|POED1_ORYSJ Polyprenol reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0576800 PE=2 SV=2 77 314 3.0E-15
sp|A2XWN6|POED1_ORYSI Polyprenol reductase 1 OS=Oryza sativa subsp. indica GN=OsI_17065 PE=3 SV=1 77 314 3.0E-15
sp|Q0P4J9|PORED_XENTR Polyprenol reductase OS=Xenopus tropicalis GN=srd5a3 PE=2 SV=1 132 315 2.0E-13
sp|Q8AVI9|PORED_XENLA Polyprenol reductase OS=Xenopus laevis GN=srd5a3 PE=2 SV=1 132 315 4.0E-13
sp|A8X8R3|PORED_CAEBR Polyprenol reductase OS=Caenorhabditis briggsae GN=CBG09584 PE=3 SV=1 133 314 4.0E-12
sp|P40526|DFG10_YEAST Polyprenol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG10 PE=1 SV=1 130 314 4.0E-11
sp|Q9H8P0|PORED_HUMAN Polyprenol reductase OS=Homo sapiens GN=SRD5A3 PE=1 SV=1 53 315 5.0E-09
sp|D2HBV9|PORED_AILME Polyprenol reductase OS=Ailuropoda melanoleuca GN=SRD5A3 PE=3 SV=1 53 315 1.0E-08
sp|Q17428|PORED_CAEEL Polyprenol reductase OS=Caenorhabditis elegans GN=B0024.13 PE=3 SV=2 145 314 2.0E-07
sp|C7T2J9|PORED_MESAU Polyprenol reductase OS=Mesocricetus auratus GN=Srd5a3 PE=2 SV=1 53 315 5.0E-07
sp|Q5RIU9|PORED_DANRE Polyprenol reductase OS=Danio rerio GN=srd5a3 PE=2 SV=1 145 314 1.0E-06
sp|Q9CAH5|POED1_ARATH Polyprenol reductase 1 OS=Arabidopsis thaliana GN=At1g72590 PE=3 SV=1 210 315 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 82 99 17
3 162 184 22
4 199 218 19
5 239 261 22
6 266 288 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2434
MPLSPAGVCQALLVAISANILALQALPQQLRSALMAYGPRRDAAVTKSGKEQDDAAKDGKTETRHDGSPLLRPWT
ISVPHSWFTFYYALSIASSAFWAWQFCRRGSLMTALAQAQVRAQPHAMHHHQQLPHVILAWAMLAFQGCRRLYEC
LCVSRLGSSNMLVLHWIVGLAFYMLAGVSVWIQGSAAILKSWQSPQPLFLLTWRVPFALALFAAASLGQNKCHRH
LASLKKYTLPNKGLFSRLVCPHYTCECLIYLAISLMAAPTGALFNHSVLACLLFTIVNLGFTARDTKQWYATKFG
PQQVAKKWAMIPLVF*
Coding >OphauB2|2434
ATGCCACTTAGTCCCGCCGGCGTCTGCCAAGCTTTGCTAGTCGCCATTTCTGCAAACATTTTGGCCTTGCAAGCC
CTGCCACAGCAGCTCCGCTCGGCTTTGATGGCGTACGGGCCGCGCCGCGACGCTGCCGTAACCAAAAGTGGAAAG
GAGCAAGACGATGCAGCAAAAGACGGCAAAACAGAGACACGTCATGACGGCAGCCCGCTGCTGCGCCCATGGACC
ATCTCGGTGCCACACTCGTGGTTCACCTTCTACTACGCCTTGTCCATTGCCTCCTCGGCCTTTTGGGCATGGCAG
TTTTGCCGCCGCGGGTCCCTCATGACGGCCCTGGCGCAGGCACAGGTCCGCGCTCAGCCCCATGCCATGCACCAC
CACCAGCAGCTCCCACACGTCATCTTGGCTTGGGCCATGCTCGCCTTCCAGGGCTGCCGTCGCCTCTACGAGTGT
CTGTGCGTCTCTAGGCTCGGCTCCTCCAACATGCTTGTCCTCCACTGGATCGTGGGCCTCGCCTTCTACATGCTG
GCAGGCGTCTCTGTCTGGATCCAAGGCTCTGCCGCCATTCTCAAGTCGTGGCAGTCGCCACAGCCCCTTTTCCTG
CTCACCTGGCGTGTGCCTTTTGCTCTAGCTCTCTTCGCCGCCGCCTCGTTGGGCCAGAACAAGTGCCATCGCCAC
CTGGCAAGCCTCAAAAAGTACACCTTGCCCAACAAAGGTCTTTTTAGCCGCCTCGTCTGCCCTCACTATACCTGC
GAGTGTCTTATTTACCTTGCCATTTCCCTCATGGCGGCACCCACGGGCGCTCTCTTCAACCACTCAGTCTTGGCT
TGTCTGCTATTTACCATTGTCAATTTGGGCTTTACAGCCCGCGACACAAAGCAGTGGTATGCCACCAAGTTTGGA
CCGCAGCAAGTCGCCAAGAAATGGGCCATGATTCCTTTGGTTTTTTAG
Transcript >OphauB2|2434
ATGCCACTTAGTCCCGCCGGCGTCTGCCAAGCTTTGCTAGTCGCCATTTCTGCAAACATTTTGGCCTTGCAAGCC
CTGCCACAGCAGCTCCGCTCGGCTTTGATGGCGTACGGGCCGCGCCGCGACGCTGCCGTAACCAAAAGTGGAAAG
GAGCAAGACGATGCAGCAAAAGACGGCAAAACAGAGACACGTCATGACGGCAGCCCGCTGCTGCGCCCATGGACC
ATCTCGGTGCCACACTCGTGGTTCACCTTCTACTACGCCTTGTCCATTGCCTCCTCGGCCTTTTGGGCATGGCAG
TTTTGCCGCCGCGGGTCCCTCATGACGGCCCTGGCGCAGGCACAGGTCCGCGCTCAGCCCCATGCCATGCACCAC
CACCAGCAGCTCCCACACGTCATCTTGGCTTGGGCCATGCTCGCCTTCCAGGGCTGCCGTCGCCTCTACGAGTGT
CTGTGCGTCTCTAGGCTCGGCTCCTCCAACATGCTTGTCCTCCACTGGATCGTGGGCCTCGCCTTCTACATGCTG
GCAGGCGTCTCTGTCTGGATCCAAGGCTCTGCCGCCATTCTCAAGTCGTGGCAGTCGCCACAGCCCCTTTTCCTG
CTCACCTGGCGTGTGCCTTTTGCTCTAGCTCTCTTCGCCGCCGCCTCGTTGGGCCAGAACAAGTGCCATCGCCAC
CTGGCAAGCCTCAAAAAGTACACCTTGCCCAACAAAGGTCTTTTTAGCCGCCTCGTCTGCCCTCACTATACCTGC
GAGTGTCTTATTTACCTTGCCATTTCCCTCATGGCGGCACCCACGGGCGCTCTCTTCAACCACTCAGTCTTGGCT
TGTCTGCTATTTACCATTGTCAATTTGGGCTTTACAGCCCGCGACACAAAGCAGTGGTATGCCACCAAGTTTGGA
CCGCAGCAAGTCGCCAAGAAATGGGCCATGATTCCTTTGGTTTTTTAG
Gene >OphauB2|2434
ATGCCACTTAGTCCCGCCGGCGTCTGCCAAGCTTTGCTAGTCGCCATTTCTGCAAACATTTTGGCCTTGCAAGCC
CTGCCACAGCAGCTCCGCTCGGCTTTGATGGCGTACGGGCCGCGCCGCGACGCTGCCGTAACCAAAAGTGGAAAG
GAGCAAGACGATGCAGCAAAAGACGGCAAAACAGAGACACGTGTAAGGCCGCTCGAGATGCGAGCAATGTTCAAC
AAGTGCACTCACATGACTCCATCATTCAGCATGACGGCAGCCCGCTGCTGCGCCCATGGACCATCTCGGTGCCAC
ACTCGTGGTTCACCTTCTACTACGCCTTGTCCATTGCCTCCTCGGCCTTTTGGGCATGGCAGTTTTGCCGCCGCG
GGTCCCTCATGACGGCCCTGGCGCAGGCACAGGTCCGCGCTCAGCCCCATGCCATGCACCACCACCAGCAGCTCC
CACACGTCATCTTGGCTTGGGCCATGCTCGCCTTCCAGGGCTGCCGTCGCCTCTACGAGTGTCTGTGCGTCTCTA
GGCTCGGCTCCTCCAACATGCTTGTCCTCCACTGGATCGTGGGCCTCGCCTTCTACATGCTGGCAGGCGTCTCTG
TCTGGATCCAAGGCTCTGGTAGTTTTCTTTCCCTTTTGCCCCTGGCCCAATTTGCCGCTGACCTTGCTTGGCTGC
CAGCCGCCATTCTCAAGTCGTGGCAGTCGCCACAGCCCCTTTTCCTGCTCACCTGGCGTGTGCCTTTTGCTCTAG
CTCTCTTCGCCGCCGCCTCGTTGGGCCAGAACAAGTGCCATCGCCACCTGGCAAGCCTCAAAAAGTACACCTTGC
CCAACAAAGGTCTTTTTAGCCGCCTCGTCTGCCCTCACTATACCTGCGAGTGTCTTATTTACCTTGCCATTTCCC
TCATGGCGGCACCCACGGGCGCTCTCTTCAACCACTCAGTCTTGGCTTGTCTGCTATTTACCATTGTCAATTTGG
GCTTTACAGCCCGCGACACAAAGCAGTGGTATGCCACCAAGTTTGGACCGCAGCAAGTCGCCAAGAAATGGGCCA
TGATTCCTTTGGTTTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail