Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2431
Gene name
LocationContig_177:19535..24481
Strand-
Gene length (bp)4946
Transcript length (bp)4725
Coding sequence length (bp)4725
Protein length (aa) 1575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.1E-12 394 482
PF13637 Ank_4 Ankyrin repeats (many copies) 6.0E-08 424 476
PF00023 Ank Ankyrin repeat 1.4E-04 423 453
PF13606 Ank_3 Ankyrin repeat 5.7E-04 423 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 362 713 3.0E-22
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 389 493 7.0E-16
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 389 494 2.0E-15
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 344 511 3.0E-13
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 353 511 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 362 713 3.0E-22
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 389 493 7.0E-16
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 389 494 2.0E-15
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 344 511 3.0E-13
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 353 511 3.0E-12
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1034 1188 2.0E-10
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 389 500 2.0E-10
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 386 499 4.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1089 1232 9.0E-10
sp|A2AQH4|BCORL_MOUSE BCL-6 corepressor-like protein 1 OS=Mus musculus GN=Bcorl1 PE=2 SV=1 389 499 3.0E-09
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 389 494 4.0E-09
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 389 494 5.0E-09
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 1048 1205 1.0E-08
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 389 494 2.0E-08
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 977 1166 9.0E-08
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 1088 1217 2.0E-07
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 1088 1217 4.0E-07
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1107 1252 5.0E-07
sp|Q75JP5|Y2471_DICDI Calponin homology domain-containing protein DDB_G0272472 OS=Dictyostelium discoideum GN=DDB_G0272472 PE=3 SV=1 1034 1252 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2431
MEAQNAADSHHTRPALSPHSRRSSSELDGPARPKSPASSRLSPPPKDSRLKSEPAPDDSLTVRPDVAHDERDSDA
ETIVLPGKHGHSPSKVRKVRQEDRSDSEGQANARAKSRPKPGDSDPNNGTTTHDSPRNASSAAPAHLPSDNAKRK
RSSLSANDKDRNSRSKDGPSGRLSSGPSSPRHEHAPSLHHHKSSHHQQSALQRASPSRRRRSDAARSSASDSEQN
LIHIPTKTSSQTLLRDKIKVGERLLSHKRKASRGDSDDEADARKARRQRTASAGLEVARPSKDAKSASTKSTGDS
HERSISPLPRHRRSISSQFPYLQNGFSAKKKRLPPPLQPTDYHSDDSSAGGSPLPRNSKLRSMASTPVATEKASP
AKMGPHKKHLDAHGQTHLARACARGEYDAAKQRLTERPEDLNVADYAGNTPLQIAAINGCEDIVKLLIEAGCNLD
CVNYDKDTPLLDAVDNGHLGVVKLLLGAGVNPRKANVNGEEPLDRVSDDTDNADEIRAALLEARRRAGERQRTSE
DRHSHHDQHDARDVGLPDSPRRSPAAMAFASTGRRTGNVRSTKTRNDLLYMPLDEKTLRQAAGRGDEETVARILQ
VKEGYDDPEAMVAAARGGHDVVMELLLSLGSAANADPAPVPSLPAEFATPILAAIGQENLKAVQLFLRHENFDPT
RRFRGETYYEIARRRQGPNWKEEEQLLKNAYDDYKRSHKDSSTKTKSPGLRRERDRDRPEKLTRREEAKEGTKGH
SKHTHSSPVREGDHKKKTSHNRVSSPLEKRRPDVLANRGDDESQKRVASRPKKDAAINASDHENSPAPPQKPHKS
RRTESDVTGMSSDGEAATKPRRKLVSKDKSKLSQKYHDRAKALRRDETVLSASSDGSSKRHRASETPDRPSDGDR
DQSEGPVKRRRIDHDSASQEKRQKRTLSVDSRARKVGSSRENAGKLSVAVAKRERDDGSRDSQELGSARSSGGGV
VEKSIHVKSEDFDMPLIDIEQSREDQRYASSRNGSDLDEQARKQDAEHDGASRREEQRKKQEAEDRKKKKKREEE
EARKRREEEEARKRREEEEEARKRREEEEARKRREEEEARKRREEEEARKRQEEEEARRRQEEEEEKQRKEEEER
VRKAEEERKRREEEEEAQKRKEQAERERREAEEAARREEAEKKRLEEEKKRKEEEELKRRQEEDRLHKEQLAREA
AEQAQRLREEEERKEREARERAHREEMERKRAAREAEQKRIHEEQERARLDRLPPLVRWLQVCPNPKTAENANKF
RHIMGVRYDTMRSEANGTTEGRELWVLNTDVAMLLGEKDLDLSRYTAWDREPVTPLAKTSMWRTQWMRHSLTPQS
LWEIGMKLPNKYYGETSPYTMKGSRVRELKLEAWERFAAMDMFFVKALDFLSIVPNVAHLREVKIAVEYHELLES
ESDSHWKIPQKWKQDPGVERFLGFAPRFTYYVNGVMTGEDIPVKTQTSKLPFVEARVPRRGMTRAYPEDPDYEKL
CREQGLEHLLVSRRTPVVANGVHASPTSQATADTTVEKATVNGLGHDLAQGATGQPGEEAPANGVGIDANGSQE*
Coding >OphauB2|2431
ATGGAGGCGCAGAATGCTGCCGACTCGCACCATACGAGACCGGCCCTTTCTCCTCACTCACGACGCTCCTCGTCT
GAGCTTGACGGCCCTGCCAGGCCCAAGTCCCCGGCCAGCTCGAGACTGTCGCCGCCCCCCAAAGACTCGAGGCTG
AAATCGGAGCCTGCCCCAGACGACTCGCTGACGGTCCGCCCCGATGTAGCCCATGATGAACGTGACTCGGATGCC
GAGACCATTGTGCTTCCGGGCAAGCACGGCCACTCACCTTCCAAGGTCCGCAAGGTGCGGCAGGAGGACAGGAGC
GACAGCGAGGGTCAAGCCAACGCCAGGGCCAAGTCACGGCCCAAGCCTGGTGACAGCGACCCCAACAACGGCACC
ACCACCCACGACAGCCCCAGGAACGCCTCGTCTGCCGCACCTGCCCATTTGCCCTCGGACAATGCAAAGAGGAAG
CGCTCGTCCCTCTCGGCCAATGACAAGGACCGCAACTCCCGCAGCAAAGATGGCCCTTCTGGCCGACTAAGCTCG
GGGCCCTCGTCGCCTCGCCACGAACATGCTCCCTCTCTCCACCATCATAAATCAAGCCATCATCAACAAAGTGCC
TTGCAGCGCGCCTCTCCCTCGCGCAGGCGCCGCTCAGATGCTGCACGCTCCTCGGCCTCGGATTCTGAGCAAAAC
CTTATTCACATCCCAACAAAGACATCATCACAGACATTGCTACGCGACAAGATCAAGGTTGGCGAGCGTCTGCTT
TCCCACAAGCGCAAGGCTTCAAGAGGTGATTCCGACGACGAGGCTGATGCCCGCAAAGCTCGCCGTCAGCGCACT
GCCAGTGCTGGTCTCGAGGTTGCCCGTCCCTCCAAAGATGCTAAATCTGCCTCGACAAAGTCGACTGGCGATTCC
CACGAGCGTTCCATCTCTCCTCTGCCCCGCCACCGGCGAAGCATCTCGTCCCAATTTCCCTATTTACAAAACGGC
TTCAGTGCCAAGAAGAAGCGCCTTCCGCCTCCTCTCCAGCCCACCGACTATCATTCGGACGACTCATCTGCCGGC
GGAAGTCCGCTGCCCCGCAACTCGAAGCTGCGCAGCATGGCGTCCACCCCCGTCGCTACAGAAAAGGCTTCTCCC
GCCAAGATGGGCCCTCACAAGAAGCATCTCGACGCCCACGGACAGACTCACTTGGCTCGTGCCTGTGCCCGCGGT
GAATACGACGCAGCCAAGCAGCGCTTGACGGAACGGCCCGAGGATTTAAATGTTGCAGACTATGCCGGAAACACG
CCACTTCAGATTGCTGCTATTAATGGTTGCGAGGACATCGTGAAGCTCTTAATCGAGGCTGGCTGCAACCTGGAC
TGTGTCAATTATGACAAGGACACTCCATTGCTCGACGCTGTCGATAATGGCCATCTTGGCGTTGTCAAATTGCTG
CTTGGAGCCGGTGTCAATCCTCGCAAGGCCAATGTCAATGGCGAGGAGCCTCTGGATCGTGTGAGTGACGATACT
GACAATGCTGACGAGATTCGTGCTGCTCTTCTTGAAGCACGTAGACGAGCAGGCGAACGACAGCGCACCTCTGAG
GATCGTCATTCGCACCATGACCAGCACGACGCTCGCGATGTTGGCTTGCCCGACAGCCCACGCCGCTCCCCTGCC
GCTATGGCTTTTGCATCCACTGGCCGTCGCACCGGCAATGTTCGCTCGACCAAGACGAGAAATGACTTGCTCTAT
ATGCCTTTGGACGAGAAGACGCTGCGCCAGGCTGCTGGCCGTGGCGACGAAGAGACGGTGGCGCGCATCCTACAG
GTCAAGGAGGGCTATGATGACCCCGAGGCCATGGTTGCCGCAGCCCGAGGCGGCCACGACGTTGTCATGGAGCTG
CTGCTTAGCTTGGGAAGCGCCGCCAATGCCGATCCGGCACCTGTGCCGTCTCTTCCAGCAGAGTTCGCCACCCCT
ATTCTTGCTGCCATTGGCCAAGAGAATCTCAAGGCTGTACAGCTTTTTCTTAGGCACGAAAACTTTGATCCTACC
CGCAGATTCAGAGGCGAGACGTATTATGAGATTGCCCGACGTCGTCAGGGCCCCAACTGGAAAGAAGAAGAGCAG
CTTTTGAAGAATGCTTATGACGATTACAAGCGAAGCCACAAGGATTCTAGCACAAAGACCAAATCCCCAGGGTTG
CGCCGCGAACGCGATCGCGACCGCCCAGAAAAGTTGACGAGACGCGAAGAGGCCAAGGAGGGCACCAAGGGCCAC
TCCAAACACACCCATTCGAGCCCTGTGCGTGAAGGAGACCACAAGAAGAAGACTTCACACAATCGAGTTTCCAGT
CCGCTGGAGAAGCGAAGGCCTGATGTGCTTGCGAATCGAGGCGACGATGAGTCACAAAAGCGCGTCGCTTCTCGG
CCCAAAAAGGACGCCGCCATTAATGCCTCGGACCACGAAAATTCACCTGCTCCACCGCAAAAGCCCCACAAGTCT
AGGCGTACCGAATCAGATGTCACTGGCATGTCTTCTGATGGAGAAGCTGCCACAAAGCCCAGACGCAAGCTGGTC
AGTAAAGACAAGTCGAAGCTTTCACAAAAGTATCATGACCGAGCCAAGGCCTTGAGACGAGACGAAACGGTCCTG
TCTGCTTCATCCGACGGGTCCTCCAAAAGACACCGAGCCAGCGAGACTCCAGACCGCCCTAGTGACGGCGATAGA
GACCAAAGTGAAGGCCCAGTCAAGCGCCGTCGAATAGACCATGACAGTGCAAGCCAAGAAAAGCGACAAAAGCGT
ACGCTTTCTGTGGATTCCCGCGCGCGCAAGGTTGGATCATCTCGAGAAAACGCTGGAAAACTGTCTGTTGCTGTT
GCTAAGAGAGAACGTGACGATGGATCCAGAGACAGTCAAGAGCTTGGCTCTGCGCGAAGCAGTGGTGGTGGTGTT
GTTGAAAAGTCGATTCACGTTAAGTCGGAAGACTTTGACATGCCCCTCATCGACATTGAGCAGTCGCGAGAAGAT
CAGAGATATGCCTCGTCGAGAAATGGTTCAGACTTGGATGAGCAGGCCAGGAAACAAGACGCTGAGCATGATGGT
GCTAGTCGGAGAGAAGAGCAACGCAAAAAACAAGAGGCCGAGGACAGAAAGAAGAAGAAGAAGCGTGAAGAGGAG
GAGGCGCGGAAGCGTCGAGAGGAGGAGGAGGCACGAAAGCGTCGAGAAGAGGAGGAGGAGGCGCGAAAGCGTCGA
GAGGAGGAGGAAGCACGAAAGCGTCGAGAGGAGGAGGAAGCACGAAAGCGTCGAGAGGAGGAGGAAGCACGAAAG
CGTCAAGAAGAGGAGGAGGCGCGAAGACGGCAAGAGGAGGAGGAGGAGAAGCAACGAAAGGAGGAGGAGGAAAGA
GTACGCAAGGCTGAAGAAGAACGCAAGAGGCGGGAAGAAGAAGAGGAAGCTCAGAAGCGCAAGGAACAGGCGGAA
CGCGAGCGACGTGAAGCCGAAGAGGCGGCCCGTCGAGAAGAGGCAGAGAAGAAGCGGCTGGAAGAGGAAAAGAAG
AGGAAGGAGGAGGAGGAGCTGAAGCGCAGGCAAGAAGAGGATCGCCTCCATAAGGAGCAGCTGGCACGCGAGGCG
GCGGAACAAGCTCAACGGCTGCGCGAAGAGGAGGAACGCAAGGAGCGAGAAGCCAGAGAGCGGGCTCATCGGGAG
GAGATGGAACGAAAGCGTGCGGCTCGCGAAGCGGAGCAGAAGCGCATCCATGAAGAGCAGGAACGCGCACGGCTT
GATAGACTGCCACCGCTGGTGCGATGGCTCCAAGTTTGTCCGAATCCAAAGACTGCGGAAAACGCCAACAAGTTC
AGACACATCATGGGCGTGCGATATGACACGATGCGATCAGAAGCCAATGGCACTACAGAAGGTCGCGAGCTATGG
GTTCTCAACACTGATGTGGCGATGCTCCTTGGCGAGAAGGACCTTGATCTTTCTAGATACACGGCTTGGGATCGA
GAGCCGGTGACGCCGCTGGCCAAGACGTCGATGTGGAGGACGCAATGGATGCGACATTCCCTGACGCCACAGTCG
CTTTGGGAGATTGGAATGAAGCTTCCCAACAAGTACTATGGCGAAACAAGTCCATATACAATGAAGGGGAGCCGT
GTCCGAGAGCTCAAGCTGGAGGCATGGGAGCGGTTTGCAGCCATGGATATGTTTTTTGTCAAGGCTTTGGATTTT
CTCAGCATCGTCCCAAACGTTGCACACTTGCGCGAGGTGAAGATTGCGGTGGAATATCACGAGCTTCTGGAAAGC
GAGAGTGACTCGCATTGGAAGATTCCGCAAAAGTGGAAGCAAGACCCCGGGGTTGAGCGCTTCCTTGGATTTGCA
CCGCGCTTCACATACTACGTCAATGGAGTCATGACTGGCGAAGACATTCCCGTCAAGACCCAGACTAGCAAGTTG
CCCTTTGTGGAAGCACGCGTGCCGCGCCGGGGGATGACGCGGGCATATCCCGAGGACCCCGACTACGAGAAGCTC
TGTCGAGAACAGGGCCTGGAGCATCTTCTTGTTTCGCGTCGCACGCCCGTGGTTGCTAATGGAGTCCACGCATCA
CCAACAAGCCAAGCGACAGCGGATACGACTGTGGAAAAGGCGACGGTTAATGGCCTGGGCCATGATTTGGCCCAA
GGTGCAACGGGGCAGCCTGGCGAAGAAGCACCTGCTAATGGCGTTGGTATCGACGCTAATGGGTCGCAAGAGTAA
Transcript >OphauB2|2431
ATGGAGGCGCAGAATGCTGCCGACTCGCACCATACGAGACCGGCCCTTTCTCCTCACTCACGACGCTCCTCGTCT
GAGCTTGACGGCCCTGCCAGGCCCAAGTCCCCGGCCAGCTCGAGACTGTCGCCGCCCCCCAAAGACTCGAGGCTG
AAATCGGAGCCTGCCCCAGACGACTCGCTGACGGTCCGCCCCGATGTAGCCCATGATGAACGTGACTCGGATGCC
GAGACCATTGTGCTTCCGGGCAAGCACGGCCACTCACCTTCCAAGGTCCGCAAGGTGCGGCAGGAGGACAGGAGC
GACAGCGAGGGTCAAGCCAACGCCAGGGCCAAGTCACGGCCCAAGCCTGGTGACAGCGACCCCAACAACGGCACC
ACCACCCACGACAGCCCCAGGAACGCCTCGTCTGCCGCACCTGCCCATTTGCCCTCGGACAATGCAAAGAGGAAG
CGCTCGTCCCTCTCGGCCAATGACAAGGACCGCAACTCCCGCAGCAAAGATGGCCCTTCTGGCCGACTAAGCTCG
GGGCCCTCGTCGCCTCGCCACGAACATGCTCCCTCTCTCCACCATCATAAATCAAGCCATCATCAACAAAGTGCC
TTGCAGCGCGCCTCTCCCTCGCGCAGGCGCCGCTCAGATGCTGCACGCTCCTCGGCCTCGGATTCTGAGCAAAAC
CTTATTCACATCCCAACAAAGACATCATCACAGACATTGCTACGCGACAAGATCAAGGTTGGCGAGCGTCTGCTT
TCCCACAAGCGCAAGGCTTCAAGAGGTGATTCCGACGACGAGGCTGATGCCCGCAAAGCTCGCCGTCAGCGCACT
GCCAGTGCTGGTCTCGAGGTTGCCCGTCCCTCCAAAGATGCTAAATCTGCCTCGACAAAGTCGACTGGCGATTCC
CACGAGCGTTCCATCTCTCCTCTGCCCCGCCACCGGCGAAGCATCTCGTCCCAATTTCCCTATTTACAAAACGGC
TTCAGTGCCAAGAAGAAGCGCCTTCCGCCTCCTCTCCAGCCCACCGACTATCATTCGGACGACTCATCTGCCGGC
GGAAGTCCGCTGCCCCGCAACTCGAAGCTGCGCAGCATGGCGTCCACCCCCGTCGCTACAGAAAAGGCTTCTCCC
GCCAAGATGGGCCCTCACAAGAAGCATCTCGACGCCCACGGACAGACTCACTTGGCTCGTGCCTGTGCCCGCGGT
GAATACGACGCAGCCAAGCAGCGCTTGACGGAACGGCCCGAGGATTTAAATGTTGCAGACTATGCCGGAAACACG
CCACTTCAGATTGCTGCTATTAATGGTTGCGAGGACATCGTGAAGCTCTTAATCGAGGCTGGCTGCAACCTGGAC
TGTGTCAATTATGACAAGGACACTCCATTGCTCGACGCTGTCGATAATGGCCATCTTGGCGTTGTCAAATTGCTG
CTTGGAGCCGGTGTCAATCCTCGCAAGGCCAATGTCAATGGCGAGGAGCCTCTGGATCGTGTGAGTGACGATACT
GACAATGCTGACGAGATTCGTGCTGCTCTTCTTGAAGCACGTAGACGAGCAGGCGAACGACAGCGCACCTCTGAG
GATCGTCATTCGCACCATGACCAGCACGACGCTCGCGATGTTGGCTTGCCCGACAGCCCACGCCGCTCCCCTGCC
GCTATGGCTTTTGCATCCACTGGCCGTCGCACCGGCAATGTTCGCTCGACCAAGACGAGAAATGACTTGCTCTAT
ATGCCTTTGGACGAGAAGACGCTGCGCCAGGCTGCTGGCCGTGGCGACGAAGAGACGGTGGCGCGCATCCTACAG
GTCAAGGAGGGCTATGATGACCCCGAGGCCATGGTTGCCGCAGCCCGAGGCGGCCACGACGTTGTCATGGAGCTG
CTGCTTAGCTTGGGAAGCGCCGCCAATGCCGATCCGGCACCTGTGCCGTCTCTTCCAGCAGAGTTCGCCACCCCT
ATTCTTGCTGCCATTGGCCAAGAGAATCTCAAGGCTGTACAGCTTTTTCTTAGGCACGAAAACTTTGATCCTACC
CGCAGATTCAGAGGCGAGACGTATTATGAGATTGCCCGACGTCGTCAGGGCCCCAACTGGAAAGAAGAAGAGCAG
CTTTTGAAGAATGCTTATGACGATTACAAGCGAAGCCACAAGGATTCTAGCACAAAGACCAAATCCCCAGGGTTG
CGCCGCGAACGCGATCGCGACCGCCCAGAAAAGTTGACGAGACGCGAAGAGGCCAAGGAGGGCACCAAGGGCCAC
TCCAAACACACCCATTCGAGCCCTGTGCGTGAAGGAGACCACAAGAAGAAGACTTCACACAATCGAGTTTCCAGT
CCGCTGGAGAAGCGAAGGCCTGATGTGCTTGCGAATCGAGGCGACGATGAGTCACAAAAGCGCGTCGCTTCTCGG
CCCAAAAAGGACGCCGCCATTAATGCCTCGGACCACGAAAATTCACCTGCTCCACCGCAAAAGCCCCACAAGTCT
AGGCGTACCGAATCAGATGTCACTGGCATGTCTTCTGATGGAGAAGCTGCCACAAAGCCCAGACGCAAGCTGGTC
AGTAAAGACAAGTCGAAGCTTTCACAAAAGTATCATGACCGAGCCAAGGCCTTGAGACGAGACGAAACGGTCCTG
TCTGCTTCATCCGACGGGTCCTCCAAAAGACACCGAGCCAGCGAGACTCCAGACCGCCCTAGTGACGGCGATAGA
GACCAAAGTGAAGGCCCAGTCAAGCGCCGTCGAATAGACCATGACAGTGCAAGCCAAGAAAAGCGACAAAAGCGT
ACGCTTTCTGTGGATTCCCGCGCGCGCAAGGTTGGATCATCTCGAGAAAACGCTGGAAAACTGTCTGTTGCTGTT
GCTAAGAGAGAACGTGACGATGGATCCAGAGACAGTCAAGAGCTTGGCTCTGCGCGAAGCAGTGGTGGTGGTGTT
GTTGAAAAGTCGATTCACGTTAAGTCGGAAGACTTTGACATGCCCCTCATCGACATTGAGCAGTCGCGAGAAGAT
CAGAGATATGCCTCGTCGAGAAATGGTTCAGACTTGGATGAGCAGGCCAGGAAACAAGACGCTGAGCATGATGGT
GCTAGTCGGAGAGAAGAGCAACGCAAAAAACAAGAGGCCGAGGACAGAAAGAAGAAGAAGAAGCGTGAAGAGGAG
GAGGCGCGGAAGCGTCGAGAGGAGGAGGAGGCACGAAAGCGTCGAGAAGAGGAGGAGGAGGCGCGAAAGCGTCGA
GAGGAGGAGGAAGCACGAAAGCGTCGAGAGGAGGAGGAAGCACGAAAGCGTCGAGAGGAGGAGGAAGCACGAAAG
CGTCAAGAAGAGGAGGAGGCGCGAAGACGGCAAGAGGAGGAGGAGGAGAAGCAACGAAAGGAGGAGGAGGAAAGA
GTACGCAAGGCTGAAGAAGAACGCAAGAGGCGGGAAGAAGAAGAGGAAGCTCAGAAGCGCAAGGAACAGGCGGAA
CGCGAGCGACGTGAAGCCGAAGAGGCGGCCCGTCGAGAAGAGGCAGAGAAGAAGCGGCTGGAAGAGGAAAAGAAG
AGGAAGGAGGAGGAGGAGCTGAAGCGCAGGCAAGAAGAGGATCGCCTCCATAAGGAGCAGCTGGCACGCGAGGCG
GCGGAACAAGCTCAACGGCTGCGCGAAGAGGAGGAACGCAAGGAGCGAGAAGCCAGAGAGCGGGCTCATCGGGAG
GAGATGGAACGAAAGCGTGCGGCTCGCGAAGCGGAGCAGAAGCGCATCCATGAAGAGCAGGAACGCGCACGGCTT
GATAGACTGCCACCGCTGGTGCGATGGCTCCAAGTTTGTCCGAATCCAAAGACTGCGGAAAACGCCAACAAGTTC
AGACACATCATGGGCGTGCGATATGACACGATGCGATCAGAAGCCAATGGCACTACAGAAGGTCGCGAGCTATGG
GTTCTCAACACTGATGTGGCGATGCTCCTTGGCGAGAAGGACCTTGATCTTTCTAGATACACGGCTTGGGATCGA
GAGCCGGTGACGCCGCTGGCCAAGACGTCGATGTGGAGGACGCAATGGATGCGACATTCCCTGACGCCACAGTCG
CTTTGGGAGATTGGAATGAAGCTTCCCAACAAGTACTATGGCGAAACAAGTCCATATACAATGAAGGGGAGCCGT
GTCCGAGAGCTCAAGCTGGAGGCATGGGAGCGGTTTGCAGCCATGGATATGTTTTTTGTCAAGGCTTTGGATTTT
CTCAGCATCGTCCCAAACGTTGCACACTTGCGCGAGGTGAAGATTGCGGTGGAATATCACGAGCTTCTGGAAAGC
GAGAGTGACTCGCATTGGAAGATTCCGCAAAAGTGGAAGCAAGACCCCGGGGTTGAGCGCTTCCTTGGATTTGCA
CCGCGCTTCACATACTACGTCAATGGAGTCATGACTGGCGAAGACATTCCCGTCAAGACCCAGACTAGCAAGTTG
CCCTTTGTGGAAGCACGCGTGCCGCGCCGGGGGATGACGCGGGCATATCCCGAGGACCCCGACTACGAGAAGCTC
TGTCGAGAACAGGGCCTGGAGCATCTTCTTGTTTCGCGTCGCACGCCCGTGGTTGCTAATGGAGTCCACGCATCA
CCAACAAGCCAAGCGACAGCGGATACGACTGTGGAAAAGGCGACGGTTAATGGCCTGGGCCATGATTTGGCCCAA
GGTGCAACGGGGCAGCCTGGCGAAGAAGCACCTGCTAATGGCGTTGGTATCGACGCTAATGGGTCGCAAGAGTAA
Gene >OphauB2|2431
ATGGAGGCGCAGAATGCTGCCGACTCGCACCATACGAGACCGGCCCTTTCTCCTCACTCACGACGCTCCTCGTCT
GAGCTTGACGGCCCTGCCAGGCCCAAGTCCCCGGCCAGCTCGAGACTGTCGCCGCCCCCCAAAGACTCGAGGCTG
AAATCGGAGCCTGCCCCAGACGACTCGCTGACGGTCCGCCCCGATGTAGCCCATGATGAACGTGACTCGGATGCC
GAGACCATTGTGCTTCCGGGCAAGCACGGCCACTCACCTTCCAAGGTCCGCAAGGTGCGGCAGGAGGACAGGAGC
GACAGCGAGGGTCAAGCCAACGCCAGGGCCAAGTCACGGCCCAAGCCTGGTGACAGCGACCCCAACAACGGCACC
ACCACCCACGACAGCCCCAGGAACGCCTCGTCTGCCGCACCTGCCCATTTGCCCTCGGACAATGCAAAGAGGAAG
CGCTCGTCCCTCTCGGCCAATGACAAGGACCGCAACTCCCGCAGCAAAGATGGCCCTTCTGGCCGACTAAGCTCG
GGGCCCTCGTCGCCTCGCCACGAACATGCTCCCTCTCTCCACCATCATAAATCAAGCCATCATCAACAAAGTGCC
TTGCAGCGCGCCTCTCCCTCGCGCAGGCGCCGCTCAGATGCTGCACGCTCCTCGGCCTCGGATTCTGAGCAAAAC
CTTATTCACATCCCAACAAAGACATCATCACAGACATTGCTACGCGACAAGATCAAGGTTGGCGAGCGTCTGCTT
TCCCACAAGCGCAAGGCTTCAAGAGGTGATTCCGACGACGAGGCTGATGCCCGCAAAGCTCGCCGTCAGCGCACT
GCCAGTGCTGGTCTCGAGGTTGCCCGTCCCTCCAAAGATGCTAAATCTGCCTCGACAAAGTCGACTGGCGATTCC
CACGAGCGTTCCATCTCTCCTCTGCCCCGCCACCGGCGAAGCATCTCGTCCCAATTTCCCTATTTACAAAACGGC
TTCAGTGCCAAGAAGAAGCGCCTTCCGCCTCCTCTCCAGCCCACCGACTATCATTCGGACGACTCATCTGCCGGC
GGAAGTCCGCTGCCCCGCAACTCGAAGCTGCGCAGCATGGCGTCCACCCCCGTCGCTACAGAAAAGGCTTCTCCC
GCCAAGATGGGCCCTCACAAGAAGCATCTCGACGCCCACGGACAGACTCACTTGGCTCGTGCCTGTGCCCGCGGT
GAATACGACGCAGCCAAGCAGCGCTTGACGGAACGGCCCGAGGATTTAAATGTTGCAGACTATGCCGGAAACACG
CCACTTCAGATTGCTGCTATTAATGGTTGCGAGGACATCGTGAAGCTCTTAATCGAGGCTGGCTGCAACCTGGAC
TGTGTCAATTATGACAAGGACACTCCATTGCTCGACGCTGTCGATAATGGCCATCTTGGCGTTGTCAAATTGCTG
CTTGGAGCCGGTGTCAATCCTCGCAAGGCCAATGTCAATGGCGAGGAGCCTCTGGATCGTGTGAGTGACGATACT
GACAATGCTGACGAGATTCGTGCTGCTCTTCTTGAAGCACGTAGACGAGCAGGCGAACGACAGCGCACCTCTGAG
GATCGTCATTCGCACCATGACCAGCACGACGCTCGCGATGTTGGCTTGCCCGACAGCCCACGCCGCTCCCCTGCC
GCTATGGCTTTTGCATCCACTGGCCGTCGCACCGGCAATGTTCGCTCGACCAAGACGAGAAATGACTTGCTCTAT
ATGCCTTTGGACGAGAAGACGCTGCGCCAGGCTGCTGGCCGTGGCGACGAAGAGACGGTGGCGCGCATCCTACAG
GTCAAGGAGGGCTATGATGACCCCGAGGCCATGGTTGCCGCAGCCCGAGGCGGCCACGACGTTGTCATGGAGCTG
CTGCTTAGCTTGGGAAGCGCCGCCAATGCCGATCCGGCACCTGTGCCGTCTCTTCCAGCAGAGTTCGCCACCCCT
ATTCTTGCTGCCATTGGCCAAGAGAATCTCAAGGCTGTACAGCTTTTTCTTAGGCACGAAAACTTTGATCCTACC
CGCAGATTCAGAGGCGAGACGTATTATGAGATTGCCCGACGTCGTCAGGGCCCCAACTGGAAAGAAGAAGAGCAG
CTTTTGAAGAATGCTTATGACGATTACAAGCGAAGCCACAAGGATTCTAGCACAAAGACCAAATCCCCAGGGTTG
CGCCGCGAACGCGATCGCGACCGCCCAGAAAAGTTGACGAGACGCGAAGAGGCCAAGGAGGGCACCAAGGGCCAC
TCCAAACACACCCATTCGAGCCCTGTGCGTGAAGGAGACCACAAGAAGAAGACTTCACACAATCGAGTTTCCAGT
CCGCTGGAGAAGCGAAGGCCTGATGTGCTTGCGAATCGAGGCGACGATGAGTCACAAAAGCGCGTCGCTTCTCGG
CCCAAAAAGGACGCCGCCATTAATGCCTCGGACCACGAAAATTCACCTGCTCCACCGCAAAAGCCCCACAAGTCT
AGGCGTACCGAATCAGATGTCACTGGCATGTCTTCTGATGGAGAAGCTGCCACAAAGCCCAGACGCAAGCTGGTC
AGTAAAGGTGAGCTTAGCCGGGAGCGTGACAAGCAGAGACGAGCACTTTTGGAGCCCTCGAGTCCTCGCGAGCCG
AGAGCCGACGAAGGTACAGACAAGTCGAAGCTTTCACAAAAGTATCATGACCGAGCCAAGGCCTTGAGACGAGAC
GAAACGGTCCTGTCTGCTTCATCCGACGGGTCCTCCAAAAGACACCGAGCCAGCGAGACTCCAGACCGCCCTAGT
GACGGCGATAGAGACCAAAGTGAAGGCCCAGTCAAGCGCCGTCGAATAGACCATGACAGTGCAAGCCAAGAAAAG
CGACAAAAGCGTACGCTTTCTGTGGATTCCCGCGCGCGCAAGGTTGGATCATCTCGAGAAAACGCTGGAAAACTG
TCTGTTGCTGTTGCTAAGAGAGAACGTGACGATGGATCCAGAGACAGTCAAGAGCTTGGCTCTGCGCGAAGCAGT
GGTGGTGGTGTTGTTGAAAAGTCGATTCACGTTAAGTCGGAAGACTTTGACATGCCCCTCATCGACATTGAGCAG
TCGCGAGAAGATCAGAGATATGCCTCGTCGAGAAATGGTTCAGACTTGGATGAGCAGGCCAGGAAACAAGACGCT
GAGCATGATGGTGCTAGTCGGAGAGAAGAGCAACGCAAAAAACAAGAGGCCGAGGACAGAAAGAAGAAGAAGAAG
CGTGAAGAGGAGGAGGCGCGGAAGCGTCGAGAGGAGGAGGAGGCACGAAAGCGTCGAGAAGAGGAGGAGGAGGCG
CGAAAGCGTCGAGAGGAGGAGGAAGCACGAAAGCGTCGAGAGGAGGAGGAAGCACGAAAGCGTCGAGAGGAGGAG
GAAGCACGAAAGCGTCAAGAAGAGGAGGAGGCGCGAAGACGGCAAGAGGAGGAGGAGGAGAAGCAACGAAAGGAG
GAGGAGGAAAGAGTACGCAAGGCTGAAGAAGAACGCAAGAGGCGGGAAGAAGAAGAGGAAGCTCAGAAGCGCAAG
GAACAGGCGGAACGCGAGCGACGTGAAGCCGAAGAGGCGGCCCGTCGAGAAGAGGCAGAGAAGAAGCGGCTGGAA
GAGGAAAAGAAGAGGAAGGAGGAGGAGGAGCTGAAGCGCAGGCAAGAAGAGGATCGCCTCCATAAGGAGCAGCTG
GCACGCGAGGCGGCGGAACAAGCTCAACGGCTGCGCGAAGAGGAGGAACGCAAGGAGCGAGAAGCCAGAGAGCGG
GCTCATCGGGAGGAGATGGAACGAAAGCGTGCGGCTCGCGAAGCGGAGCAGAAGCGCATCCATGAAGAGCAGGAA
CGCGCACGGCTTGATAGACTGCCACCGCTGGTGCGATGGCTCCAAGTTTGTCCGAATCCAAAGACTGCGGAAAAC
GCCAACAAGTTCAGACACATCATGGGCGTGCGATATGACACGATGCGATCAGAAGCCAATGGCACTACAGAAGGT
CGCGAGCTATGGGTTCTCAACACTGATGTGGCGATGCTCCTTGGCGAGAAGGACCTTGATCTTTCTAGATGTAAG
AAGCTGGCGCGACTGCTGCCCGACTTGTTTTTTTGATGCGCTAACCAACAGGGCAGACACGGCTTGGGATCGAGA
GCCGGTGACGCCGCTGGCCAAGACGTCGATGTGGAGGACGCAATGGATGCGACATTCCCTGACGCCACAGTCGCT
TTGGGAGATTGGAATGAAGCTTCCCAACAAGTACTATGGCGAAACAAGTCCATATACAATGAAGGGGAGCCGTGT
CCGAGAGCTCAAGCTGGAGGCATGGGAGCGGTTTGCAGCCATGGATATGTTTTTTGTCAAGGTGAGGAAGAAGGA
CCTGAAGAAGGGCTGGCTGCAGAGGCAACACTATCAAGCTAACAGTTGGTGGTGGACAGGCTTTGGATTTTCTCA
GCATCGTCCCAAACGTTGCACACTTGCGCGAGGTGAAGATTGCGGTGGAATATCACGAGCTTCTGGAAAGCGAGA
GTGACTCGCATTGGAAGATTCCGCAAAAGTGGAAGCAAGACCCCGGGGTTGAGCGCTTCCTTGGATTTGCACCGC
GCTTCACATACTACGTCAATGGAGTCATGACTGGCGAAGACATTCCCGTCAAGACCCAGACTAGCAAGTTGCCCT
TTGTGGAAGCACGCGTGCCGCGCCGGGGGATGACGCGGGCATATCCCGAGGACCCCGACTACGAGAAGCTCTGTC
GAGAACAGGGCCTGGAGCATCTTCTTGTTTCGCGTCGCACGCCCGTGGTTGCTAATGGAGTCCACGCATCACCAA
CAAGCCAAGCGACAGCGGATACGACTGTGGAAAAGGCGACGGTTAATGGCCTGGGCCATGATTTGGCCCAAGGTG
CAACGGGGCAGCCTGGCGAAGAAGCACCTGCTAATGGCGTTGGTATCGACGCTAATGGGTCGCAAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail