Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|243
Gene name
LocationContig_10:218643..223704
Strand+
Gene length (bp)5061
Transcript length (bp)5007
Coding sequence length (bp)5007
Protein length (aa) 1669

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12906 RINGv RING-variant domain 1.3E-16 37 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 732 1659 1.0E-78
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 31 216 4.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1008 1206 6.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 36 147 3.0E-27
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 998 1365 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 732 1659 1.0E-78
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 31 216 4.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1008 1206 6.0E-30
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 36 147 3.0E-27
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 998 1365 2.0E-25
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 32 102 5.0E-24
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 32 102 6.0E-24
sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 32 102 6.0E-24
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 1018 1148 1.0E-20
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 1018 1148 1.0E-20
sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 1018 1148 2.0E-20
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 30 107 5.0E-17
sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus musculus GN=March8 PE=2 SV=1 3 87 8.0E-14
sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Homo sapiens GN=MARCH1 PE=1 SV=1 2 87 1.0E-13
sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus musculus GN=March1 PE=1 SV=2 2 87 1.0E-13
sp|Q5XH39|MARH8_XENLA E3 ubiquitin-protein ligase MARCH8 OS=Xenopus laevis GN=march8 PE=2 SV=2 13 87 9.0E-13
sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xenopus tropicalis GN=march8 PE=2 SV=1 17 87 1.0E-12
sp|Q0VD59|MARH8_BOVIN E3 ubiquitin-protein ligase MARCH8 OS=Bos taurus GN=MARCH8 PE=2 SV=1 27 87 2.0E-12
sp|Q5T0T0|MARH8_HUMAN E3 ubiquitin-protein ligase MARCH8 OS=Homo sapiens GN=MARCH8 PE=1 SV=1 30 87 4.0E-12
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 1339 1660 6.0E-11
sp|Q28EX7|MARH2_XENTR E3 ubiquitin-protein ligase MARCH2 OS=Xenopus tropicalis GN=march2 PE=2 SV=1 24 87 6.0E-10
sp|Q5PQ35|MARH2_XENLA E3 ubiquitin-protein ligase MARCH2 OS=Xenopus laevis GN=march2 PE=2 SV=1 24 87 6.0E-10
sp|Q68FA7|MARH3_XENTR E3 ubiquitin-protein ligase MARCH3 OS=Xenopus tropicalis GN=march3 PE=2 SV=1 36 90 6.0E-10
sp|Q0IH10|MARH3_XENLA E3 ubiquitin-protein ligase MARCH3 OS=Xenopus laevis GN=march3 PE=2 SV=1 36 90 7.0E-10
sp|Q99M02|MARH2_MOUSE E3 ubiquitin-protein ligase MARCH2 OS=Mus musculus GN=March2 PE=2 SV=1 24 95 2.0E-09
sp|Q5I0I2|MARH2_RAT E3 ubiquitin-protein ligase MARCH2 OS=Rattus norvegicus GN=March2 PE=1 SV=1 24 95 2.0E-09
sp|Q9P0N8|MARH2_HUMAN E3 ubiquitin-protein ligase MARCH2 OS=Homo sapiens GN=MARCH2 PE=1 SV=1 24 95 3.0E-09
sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos taurus GN=MARCH3 PE=2 SV=1 36 89 5.0E-09
sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Homo sapiens GN=MARCH3 PE=2 SV=1 36 89 5.0E-09
sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattus norvegicus GN=March3 PE=1 SV=1 36 89 6.0E-09
sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus musculus GN=March3 PE=2 SV=1 36 89 6.0E-09
sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Danio rerio GN=march2 PE=2 SV=1 24 95 1.0E-08
sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos taurus GN=MARCH2 PE=2 SV=1 36 91 3.0E-08
sp|Q9H992|MARH7_HUMAN E3 ubiquitin-protein ligase MARCH7 OS=Homo sapiens GN=MARCH7 PE=1 SV=1 37 84 1.0E-06
sp|Q5R9W2|MARH7_PONAB E3 ubiquitin-protein ligase MARCH7 OS=Pongo abelii GN=MARCH7 PE=2 SV=1 37 84 1.0E-06
sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 36 92 2.0E-06
sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus musculus GN=March11 PE=2 SV=2 36 92 2.0E-06
sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo sapiens GN=MARCH11 PE=2 SV=3 15 83 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 119 138 19
2 744 766 22
3 805 827 22
4 873 895 22
5 908 930 22
6 961 979 18
7 1011 1033 22
8 1053 1075 22
9 1117 1139 22
10 1159 1178 19
11 1345 1367 22
12 1387 1405 18
13 1447 1469 22
14 1509 1531 22
15 1567 1589 22
16 1604 1626 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|243
MEPSESSSHGVLSPAPSQPESRSKALSHATDAAPGICRICRGEGTATEPLFYPCKCSGSIKYVHQDCLMEWLSHS
QKKYCELCKMPFRFTKLYAPDMPKTLPAHVFLEHMARYTVRNLLSWLRIAVALSVWTFWLPYFQRCVWSFMFWLS
DGGVGAGPPTSDLRTAENELQSLACASPLGVCPASPLLAAHGTSPAQAAMMPGGMSTVQITEVLVRFLLGSYGMT
LRFSHSDNNGLQFNSSLAYVDTDTNWFFTETPSLLGSIAFLRHLTRSPQLNRAVVDVLEGQAITILVIVSFILVI
LVRDYVVQQQPELNLRAAFDAAEHQLNPEALGHPHAAAPAELAAHQAEADSDDETLDDQGQPTRPTATEDQAQET
SDSWTEQDSLRDSSRELENTRILMSSLSSGYDISNRSGIEAMASNSADDESNLGHYLQLYRRAGGDRERILEIVE
AEGLEDKLHHWVDVAQQTITAKEDIGRKFADLLTSKSAAASYASRHLPARGNVESDNGPQQLDASASALTAPAMS
DDSSHSGSREKHKQVWPPIPQVSPSQPRQRSSSHGPRLQASPSPSDDDVRLGSEYLFPDFANNSSTADEDSTMTL
GPQDALLPVEDAHGEATPEMQVAGEGDLQVEQPQEAAIVDAAPSSGAIDEASANRQQTGLTGRIADFMWGNLDEN
QNANADDNQEVDEEDLWVDVPMGEDLEGDDADGENGGRGARNAEALEEMEDLEDFDGAMELIGVRGPLIGLFQNA
IFCSILVSVTVFGCVFVPYNLGRIALVIAADPLQLLRVLLEFSKMAQDAAIMIGALVSWCFLNLVDIVTSILGGA
LGAKVVVARRASWMMWTGAGNRIWDFALITLPMSSSDLQSFSVLSHEALVAVKSALAAGVGSLYYNVASIPSRDF
HIADGKLLSIMSGFMTSLAAYIQMAFSLLIDPKSWVIDLSNRMEPRPSTTADVAWSNSDRFWAILAGYLTISAIG
ALYLRRGTPFSRNNLLHAWEAGIIDTLQQASGIIKVILVISIEMLVFPLYCGILLDIALLPIFENATIKSRLVFT
YNFPLTSAFVHWFAGTGYMFHFALFVAMCRKIVRPGVLYFIRDPDDPEFHPVRDVLERSLAAQLKKILFSALIYG
ALVTVGLGGVVWTLSYTMPGILPIHYSSNEPVLEFPVDLLFYNFLMPLAVRILKPNDRLHTTYTWWFRKCARCLR
LTHFLFGERRIDEEGTLQLASGAASKWPSAFTWLQLTERNKVVRMTWRDVAKAISADPNSLPPVGGEAMMRQRKK
ALVKTRQLVKSGRFVRAPATDRVRIPKGRHVFLEVWETGQHKHERPENDFYMTDQFKLVYVPPSFRTRIFLLILS
IWLFAGITGIGITVVPLVFGRVFFKALIPSHVRTNDIYAFSIGIYILGTLVFSALRIQRIASAVRSRAQAAWNNM
TASGLAGRVASEFVRAVKIAYAYFSVIVVVPLVLSLIIELYLAIPLDTYMNPPATLASEATTEGRSSVIGPQKAI
GSASHSILLIQAWTLGVLYLNLGCKMILSLAPESRMAIALRSVLRHGFLRPDVGVLTRAFIIPATAVAIIAAFGP
PLLVRMALALGSLFGPESIPSSTVLLYRYSYPAAALFGLVAQGVIGLGGILRGWKTRIRDEAYLIGERLHNFGAA
TAGSRTAKKAWGAGRPRV*
Coding >OphauB2|243
ATGGAACCCTCAGAGAGCAGCAGCCATGGAGTCCTTTCACCAGCCCCCTCTCAGCCCGAGTCCCGCTCCAAGGCT
CTCTCGCACGCCACCGATGCTGCACCAGGCATTTGCCGCATCTGTCGCGGCGAGGGCACGGCGACGGAGCCTCTC
TTCTATCCCTGCAAATGCAGTGGCAGCATCAAATATGTCCATCAAGACTGCCTGATGGAGTGGCTGTCGCACTCT
CAAAAGAAGTACTGCGAGCTGTGCAAGATGCCCTTCCGCTTCACCAAACTCTACGCCCCCGACATGCCAAAGACA
TTGCCGGCACACGTTTTCCTCGAGCACATGGCCAGATATACAGTGCGCAACCTCCTCTCCTGGCTGCGCATAGCA
GTGGCCCTCAGCGTCTGGACTTTTTGGCTGCCATACTTTCAGCGCTGCGTCTGGTCCTTTATGTTCTGGCTGAGC
GATGGCGGCGTGGGTGCCGGCCCTCCGACTTCGGACCTCAGGACGGCAGAAAACGAGCTACAATCCCTGGCATGT
GCGTCGCCACTTGGAGTTTGCCCGGCAAGTCCACTCCTGGCCGCTCATGGCACCTCGCCAGCTCAGGCGGCCATG
ATGCCGGGAGGTATGAGCACGGTGCAAATCACAGAGGTCCTTGTGCGCTTCCTCCTTGGTTCCTACGGCATGACC
CTTCGCTTCAGCCACTCTGATAATAATGGCTTGCAGTTCAACAGTAGTCTTGCATATGTAGACACCGACACCAAC
TGGTTCTTCACCGAGACGCCGTCCCTACTAGGCAGCATAGCCTTCCTCCGCCACCTTACCCGGAGCCCCCAGCTC
AACCGCGCCGTTGTCGATGTCCTTGAGGGTCAAGCCATTACTATTCTCGTCATTGTCTCCTTTATTCTCGTCATA
CTTGTCCGAGACTATGTAGTGCAGCAGCAGCCAGAGCTGAATCTTCGCGCAGCCTTTGATGCCGCCGAGCATCAA
CTCAACCCCGAGGCTCTTGGGCATCCTCACGCTGCTGCCCCCGCTGAACTTGCGGCCCATCAAGCAGAAGCAGAC
TCTGACGACGAGACTCTGGATGACCAAGGTCAACCCACGAGACCCACGGCAACCGAAGACCAGGCCCAAGAGACT
TCTGATTCCTGGACAGAACAAGATTCTCTCCGTGATTCCTCTAGAGAGCTCGAGAATACTCGTATTCTCATGTCT
TCGCTCTCGTCGGGCTATGACATCTCAAATAGGTCAGGTATAGAGGCCATGGCCTCCAATAGCGCTGACGATGAG
TCGAATCTTGGCCACTATCTTCAGTTGTACCGTCGAGCAGGCGGAGACCGGGAAAGGATATTGGAGATTGTTGAG
GCGGAAGGTCTCGAGGATAAGCTGCACCACTGGGTCGACGTGGCGCAACAGACCATCACTGCAAAGGAAGACATT
GGCCGCAAGTTTGCCGATTTGTTGACTTCCAAGTCAGCTGCAGCATCATATGCATCTCGTCATTTACCAGCAAGA
GGAAATGTTGAGTCGGATAATGGCCCACAACAATTGGATGCTTCAGCTTCCGCTCTCACAGCCCCTGCCATGTCT
GACGATTCATCGCATTCTGGCTCGAGGGAAAAACACAAACAAGTTTGGCCACCTATACCTCAAGTCTCGCCGAGT
CAGCCGCGCCAACGCTCCTCGTCACACGGTCCTCGTCTACAAGCATCGCCATCGCCATCCGACGACGACGTTCGA
TTGGGCTCTGAGTATCTGTTTCCAGACTTTGCCAACAACAGCTCTACTGCAGATGAAGATTCTACCATGACCCTG
GGGCCGCAGGATGCATTGTTGCCTGTTGAGGACGCCCATGGCGAAGCTACACCAGAGATGCAGGTCGCTGGAGAA
GGCGACTTGCAGGTGGAACAACCTCAAGAAGCCGCCATTGTTGATGCAGCTCCGAGCTCTGGAGCCATTGATGAG
GCCTCTGCTAATAGACAGCAAACAGGCTTAACAGGACGTATTGCCGACTTCATGTGGGGCAACCTTGACGAGAAT
CAAAACGCCAACGCAGACGATAATCAAGAAGTTGACGAGGAGGATTTATGGGTCGATGTGCCCATGGGCGAAGAC
CTGGAAGGCGACGATGCAGATGGTGAAAACGGCGGACGCGGGGCTCGAAATGCCGAGGCCCTTGAAGAAATGGAA
GACTTGGAAGACTTTGATGGCGCAATGGAGCTCATTGGCGTCCGTGGGCCCCTTATCGGCCTCTTTCAAAACGCC
ATCTTTTGCTCCATCCTCGTCTCCGTCACGGTGTTTGGCTGCGTCTTTGTGCCCTACAACCTCGGGCGAATCGCA
CTCGTCATTGCCGCCGATCCATTGCAACTGCTTCGCGTCTTGTTGGAATTTTCAAAGATGGCCCAAGATGCTGCC
ATTATGATTGGCGCGCTTGTTTCGTGGTGTTTTCTGAACCTTGTCGATATCGTCACAAGCATCCTCGGCGGAGCT
TTGGGCGCCAAGGTGGTGGTCGCGCGGCGAGCCTCTTGGATGATGTGGACCGGAGCGGGTAACCGCATCTGGGAC
TTTGCCCTCATCACTTTGCCCATGTCTTCCTCCGATCTTCAGAGCTTCTCGGTTCTCAGCCACGAAGCCCTTGTG
GCCGTCAAGAGCGCATTGGCGGCGGGAGTTGGCAGCCTTTATTACAATGTAGCCTCGATACCCTCTCGAGACTTC
CACATTGCCGACGGCAAATTGTTGAGCATCATGTCAGGCTTCATGACGTCGTTGGCTGCCTACATTCAGATGGCT
TTTTCGCTTCTCATCGACCCCAAGTCGTGGGTGATTGACTTGAGCAATAGAATGGAGCCGCGTCCTTCAACCACT
GCCGACGTGGCATGGTCAAATTCAGATCGTTTCTGGGCCATTTTGGCCGGTTACCTGACCATATCTGCCATTGGT
GCCCTGTACCTAAGACGAGGCACGCCATTTTCTCGCAACAACTTGCTCCACGCATGGGAAGCGGGCATTATCGAC
ACTCTGCAACAGGCCAGCGGCATAATCAAGGTCATTTTGGTCATTAGCATCGAGATGCTAGTCTTTCCTCTTTAC
TGCGGCATTCTCCTTGACATTGCTCTGCTGCCTATATTCGAAAATGCGACTATCAAGTCTCGTCTCGTCTTTACC
TACAATTTCCCCCTCACTTCTGCATTCGTTCACTGGTTTGCTGGCACTGGATACATGTTCCATTTTGCCCTTTTT
GTCGCCATGTGTCGCAAGATTGTGCGTCCGGGCGTCTTGTATTTTATCCGAGACCCTGATGACCCTGAATTCCAC
CCGGTCCGTGACGTGCTTGAAAGGAGCCTTGCCGCGCAACTAAAAAAGATTTTGTTCTCGGCACTGATATATGGT
GCTTTGGTCACTGTTGGGCTTGGCGGTGTGGTCTGGACATTGTCTTATACCATGCCTGGCATTCTGCCTATACAC
TACTCCTCAAACGAGCCCGTCTTGGAATTCCCGGTTGATTTACTATTTTACAACTTCCTCATGCCTTTGGCTGTC
AGGATACTCAAGCCAAACGATCGACTGCATACTACTTATACCTGGTGGTTCCGTAAATGCGCTCGCTGTCTTCGA
CTTACCCACTTTCTCTTTGGCGAGCGGAGAATTGACGAAGAAGGCACATTGCAACTTGCATCAGGGGCCGCTTCC
AAGTGGCCGTCGGCCTTTACGTGGCTCCAGCTGACTGAACGGAATAAAGTGGTGCGCATGACTTGGCGTGACGTT
GCCAAAGCCATTAGCGCCGATCCAAATTCTCTTCCGCCTGTTGGTGGCGAGGCCATGATGAGACAAAGGAAAAAG
GCATTGGTCAAGACACGACAACTTGTCAAGAGTGGACGCTTCGTGCGCGCACCCGCAACAGATCGCGTCCGGATC
CCAAAGGGAAGACATGTCTTTCTCGAGGTGTGGGAAACTGGCCAGCACAAGCATGAAAGACCAGAAAACGACTTT
TATATGACGGATCAATTCAAGCTCGTCTATGTTCCGCCCAGTTTCCGCACCAGAATCTTCCTGCTCATCCTTTCC
ATCTGGCTCTTTGCAGGCATCACGGGTATTGGCATAACCGTCGTCCCCCTCGTTTTTGGGCGCGTCTTTTTCAAG
GCTCTGATTCCGAGCCATGTTCGGACAAACGATATTTATGCATTCAGCATTGGCATCTATATTCTTGGCACCCTT
GTTTTCTCCGCGCTTAGGATCCAACGTATCGCCTCGGCTGTTCGAAGCCGGGCTCAAGCAGCATGGAACAACATG
ACGGCAAGTGGATTGGCTGGACGCGTAGCCTCTGAGTTTGTTCGCGCCGTCAAGATTGCATACGCCTATTTTTCA
GTCATTGTCGTGGTGCCGCTTGTGCTCTCCTTGATCATTGAGCTGTACCTTGCCATACCCCTGGATACCTACATG
AACCCTCCTGCAACGTTGGCCTCTGAGGCAACAACAGAAGGGCGCAGCAGCGTTATTGGACCGCAAAAGGCGATT
GGTTCTGCATCACATAGCATTCTTCTCATCCAGGCCTGGACCTTGGGGGTTCTCTACCTTAACCTGGGCTGCAAG
ATGATACTGTCTCTGGCTCCAGAGAGTCGCATGGCAATTGCACTAAGGAGCGTTTTGCGCCATGGCTTTCTGCGA
CCCGACGTTGGAGTTTTGACGCGCGCCTTTATTATCCCCGCCACTGCTGTGGCGATTATTGCAGCATTTGGGCCG
CCACTGCTTGTCAGGATGGCTTTGGCGCTTGGCAGCTTATTTGGACCTGAGAGCATACCAAGTAGCACAGTCTTG
CTGTACAGATATTCCTACCCTGCTGCTGCTTTGTTTGGACTCGTGGCTCAAGGCGTCATTGGTTTGGGAGGCATC
TTGCGGGGATGGAAGACGCGCATACGCGATGAGGCCTATTTGATTGGAGAGCGATTGCACAACTTTGGAGCGGCA
ACAGCAGGATCAAGGACGGCGAAAAAAGCCTGGGGGGCTGGTAGGCCCCGTGTGTAA
Transcript >OphauB2|243
ATGGAACCCTCAGAGAGCAGCAGCCATGGAGTCCTTTCACCAGCCCCCTCTCAGCCCGAGTCCCGCTCCAAGGCT
CTCTCGCACGCCACCGATGCTGCACCAGGCATTTGCCGCATCTGTCGCGGCGAGGGCACGGCGACGGAGCCTCTC
TTCTATCCCTGCAAATGCAGTGGCAGCATCAAATATGTCCATCAAGACTGCCTGATGGAGTGGCTGTCGCACTCT
CAAAAGAAGTACTGCGAGCTGTGCAAGATGCCCTTCCGCTTCACCAAACTCTACGCCCCCGACATGCCAAAGACA
TTGCCGGCACACGTTTTCCTCGAGCACATGGCCAGATATACAGTGCGCAACCTCCTCTCCTGGCTGCGCATAGCA
GTGGCCCTCAGCGTCTGGACTTTTTGGCTGCCATACTTTCAGCGCTGCGTCTGGTCCTTTATGTTCTGGCTGAGC
GATGGCGGCGTGGGTGCCGGCCCTCCGACTTCGGACCTCAGGACGGCAGAAAACGAGCTACAATCCCTGGCATGT
GCGTCGCCACTTGGAGTTTGCCCGGCAAGTCCACTCCTGGCCGCTCATGGCACCTCGCCAGCTCAGGCGGCCATG
ATGCCGGGAGGTATGAGCACGGTGCAAATCACAGAGGTCCTTGTGCGCTTCCTCCTTGGTTCCTACGGCATGACC
CTTCGCTTCAGCCACTCTGATAATAATGGCTTGCAGTTCAACAGTAGTCTTGCATATGTAGACACCGACACCAAC
TGGTTCTTCACCGAGACGCCGTCCCTACTAGGCAGCATAGCCTTCCTCCGCCACCTTACCCGGAGCCCCCAGCTC
AACCGCGCCGTTGTCGATGTCCTTGAGGGTCAAGCCATTACTATTCTCGTCATTGTCTCCTTTATTCTCGTCATA
CTTGTCCGAGACTATGTAGTGCAGCAGCAGCCAGAGCTGAATCTTCGCGCAGCCTTTGATGCCGCCGAGCATCAA
CTCAACCCCGAGGCTCTTGGGCATCCTCACGCTGCTGCCCCCGCTGAACTTGCGGCCCATCAAGCAGAAGCAGAC
TCTGACGACGAGACTCTGGATGACCAAGGTCAACCCACGAGACCCACGGCAACCGAAGACCAGGCCCAAGAGACT
TCTGATTCCTGGACAGAACAAGATTCTCTCCGTGATTCCTCTAGAGAGCTCGAGAATACTCGTATTCTCATGTCT
TCGCTCTCGTCGGGCTATGACATCTCAAATAGGTCAGGTATAGAGGCCATGGCCTCCAATAGCGCTGACGATGAG
TCGAATCTTGGCCACTATCTTCAGTTGTACCGTCGAGCAGGCGGAGACCGGGAAAGGATATTGGAGATTGTTGAG
GCGGAAGGTCTCGAGGATAAGCTGCACCACTGGGTCGACGTGGCGCAACAGACCATCACTGCAAAGGAAGACATT
GGCCGCAAGTTTGCCGATTTGTTGACTTCCAAGTCAGCTGCAGCATCATATGCATCTCGTCATTTACCAGCAAGA
GGAAATGTTGAGTCGGATAATGGCCCACAACAATTGGATGCTTCAGCTTCCGCTCTCACAGCCCCTGCCATGTCT
GACGATTCATCGCATTCTGGCTCGAGGGAAAAACACAAACAAGTTTGGCCACCTATACCTCAAGTCTCGCCGAGT
CAGCCGCGCCAACGCTCCTCGTCACACGGTCCTCGTCTACAAGCATCGCCATCGCCATCCGACGACGACGTTCGA
TTGGGCTCTGAGTATCTGTTTCCAGACTTTGCCAACAACAGCTCTACTGCAGATGAAGATTCTACCATGACCCTG
GGGCCGCAGGATGCATTGTTGCCTGTTGAGGACGCCCATGGCGAAGCTACACCAGAGATGCAGGTCGCTGGAGAA
GGCGACTTGCAGGTGGAACAACCTCAAGAAGCCGCCATTGTTGATGCAGCTCCGAGCTCTGGAGCCATTGATGAG
GCCTCTGCTAATAGACAGCAAACAGGCTTAACAGGACGTATTGCCGACTTCATGTGGGGCAACCTTGACGAGAAT
CAAAACGCCAACGCAGACGATAATCAAGAAGTTGACGAGGAGGATTTATGGGTCGATGTGCCCATGGGCGAAGAC
CTGGAAGGCGACGATGCAGATGGTGAAAACGGCGGACGCGGGGCTCGAAATGCCGAGGCCCTTGAAGAAATGGAA
GACTTGGAAGACTTTGATGGCGCAATGGAGCTCATTGGCGTCCGTGGGCCCCTTATCGGCCTCTTTCAAAACGCC
ATCTTTTGCTCCATCCTCGTCTCCGTCACGGTGTTTGGCTGCGTCTTTGTGCCCTACAACCTCGGGCGAATCGCA
CTCGTCATTGCCGCCGATCCATTGCAACTGCTTCGCGTCTTGTTGGAATTTTCAAAGATGGCCCAAGATGCTGCC
ATTATGATTGGCGCGCTTGTTTCGTGGTGTTTTCTGAACCTTGTCGATATCGTCACAAGCATCCTCGGCGGAGCT
TTGGGCGCCAAGGTGGTGGTCGCGCGGCGAGCCTCTTGGATGATGTGGACCGGAGCGGGTAACCGCATCTGGGAC
TTTGCCCTCATCACTTTGCCCATGTCTTCCTCCGATCTTCAGAGCTTCTCGGTTCTCAGCCACGAAGCCCTTGTG
GCCGTCAAGAGCGCATTGGCGGCGGGAGTTGGCAGCCTTTATTACAATGTAGCCTCGATACCCTCTCGAGACTTC
CACATTGCCGACGGCAAATTGTTGAGCATCATGTCAGGCTTCATGACGTCGTTGGCTGCCTACATTCAGATGGCT
TTTTCGCTTCTCATCGACCCCAAGTCGTGGGTGATTGACTTGAGCAATAGAATGGAGCCGCGTCCTTCAACCACT
GCCGACGTGGCATGGTCAAATTCAGATCGTTTCTGGGCCATTTTGGCCGGTTACCTGACCATATCTGCCATTGGT
GCCCTGTACCTAAGACGAGGCACGCCATTTTCTCGCAACAACTTGCTCCACGCATGGGAAGCGGGCATTATCGAC
ACTCTGCAACAGGCCAGCGGCATAATCAAGGTCATTTTGGTCATTAGCATCGAGATGCTAGTCTTTCCTCTTTAC
TGCGGCATTCTCCTTGACATTGCTCTGCTGCCTATATTCGAAAATGCGACTATCAAGTCTCGTCTCGTCTTTACC
TACAATTTCCCCCTCACTTCTGCATTCGTTCACTGGTTTGCTGGCACTGGATACATGTTCCATTTTGCCCTTTTT
GTCGCCATGTGTCGCAAGATTGTGCGTCCGGGCGTCTTGTATTTTATCCGAGACCCTGATGACCCTGAATTCCAC
CCGGTCCGTGACGTGCTTGAAAGGAGCCTTGCCGCGCAACTAAAAAAGATTTTGTTCTCGGCACTGATATATGGT
GCTTTGGTCACTGTTGGGCTTGGCGGTGTGGTCTGGACATTGTCTTATACCATGCCTGGCATTCTGCCTATACAC
TACTCCTCAAACGAGCCCGTCTTGGAATTCCCGGTTGATTTACTATTTTACAACTTCCTCATGCCTTTGGCTGTC
AGGATACTCAAGCCAAACGATCGACTGCATACTACTTATACCTGGTGGTTCCGTAAATGCGCTCGCTGTCTTCGA
CTTACCCACTTTCTCTTTGGCGAGCGGAGAATTGACGAAGAAGGCACATTGCAACTTGCATCAGGGGCCGCTTCC
AAGTGGCCGTCGGCCTTTACGTGGCTCCAGCTGACTGAACGGAATAAAGTGGTGCGCATGACTTGGCGTGACGTT
GCCAAAGCCATTAGCGCCGATCCAAATTCTCTTCCGCCTGTTGGTGGCGAGGCCATGATGAGACAAAGGAAAAAG
GCATTGGTCAAGACACGACAACTTGTCAAGAGTGGACGCTTCGTGCGCGCACCCGCAACAGATCGCGTCCGGATC
CCAAAGGGAAGACATGTCTTTCTCGAGGTGTGGGAAACTGGCCAGCACAAGCATGAAAGACCAGAAAACGACTTT
TATATGACGGATCAATTCAAGCTCGTCTATGTTCCGCCCAGTTTCCGCACCAGAATCTTCCTGCTCATCCTTTCC
ATCTGGCTCTTTGCAGGCATCACGGGTATTGGCATAACCGTCGTCCCCCTCGTTTTTGGGCGCGTCTTTTTCAAG
GCTCTGATTCCGAGCCATGTTCGGACAAACGATATTTATGCATTCAGCATTGGCATCTATATTCTTGGCACCCTT
GTTTTCTCCGCGCTTAGGATCCAACGTATCGCCTCGGCTGTTCGAAGCCGGGCTCAAGCAGCATGGAACAACATG
ACGGCAAGTGGATTGGCTGGACGCGTAGCCTCTGAGTTTGTTCGCGCCGTCAAGATTGCATACGCCTATTTTTCA
GTCATTGTCGTGGTGCCGCTTGTGCTCTCCTTGATCATTGAGCTGTACCTTGCCATACCCCTGGATACCTACATG
AACCCTCCTGCAACGTTGGCCTCTGAGGCAACAACAGAAGGGCGCAGCAGCGTTATTGGACCGCAAAAGGCGATT
GGTTCTGCATCACATAGCATTCTTCTCATCCAGGCCTGGACCTTGGGGGTTCTCTACCTTAACCTGGGCTGCAAG
ATGATACTGTCTCTGGCTCCAGAGAGTCGCATGGCAATTGCACTAAGGAGCGTTTTGCGCCATGGCTTTCTGCGA
CCCGACGTTGGAGTTTTGACGCGCGCCTTTATTATCCCCGCCACTGCTGTGGCGATTATTGCAGCATTTGGGCCG
CCACTGCTTGTCAGGATGGCTTTGGCGCTTGGCAGCTTATTTGGACCTGAGAGCATACCAAGTAGCACAGTCTTG
CTGTACAGATATTCCTACCCTGCTGCTGCTTTGTTTGGACTCGTGGCTCAAGGCGTCATTGGTTTGGGAGGCATC
TTGCGGGGATGGAAGACGCGCATACGCGATGAGGCCTATTTGATTGGAGAGCGATTGCACAACTTTGGAGCGGCA
ACAGCAGGATCAAGGACGGCGAAAAAAGCCTGGGGGGCTGGTAGGCCCCGTGTGTAA
Gene >OphauB2|243
ATGGAACCCTCAGAGAGCAGCAGCCATGGAGTCCTTTCACCAGCCCCCTCTCAGCCCGAGTCCCGCTCCAAGGCT
CTCTCGCACGCCACCGATGCTGCACCAGGCATTTGCCGCATCTGTCGCGGCGAGGGCACGGCGACGGAGCCTCTC
TTCTATCCCTGCAAATGCAGTGGCAGCATCAAATATGTCCATCAAGACTGCCTGATGGAGTGGCTGTCGCACTCT
CAAAAGAAGTACTGCGAGCTGTGCAAGATGCCCTTCCGCTTCACCAAACTCTACGCCCCCGACATGCCAAAGACA
TTGCCGGCACACGTTTTCCTCGAGCACATGGCCAGATATACAGTGCGCAACCTCCTCTCCTGGCTGCGCATAGCA
GTGGCCCTCAGCGTCTGGACTTTTTGGCTGCCATACTTTCAGCGCTGCGTCTGGTCCTTTATGTTCTGGCTGAGC
GATGGCGGCGTGGGTGCCGGCCCTCCGACTTCGGACCTCAGGACGGCAGAAAACGAGCTACAATCCCTGGCATGT
GCGTCGCCACTTGGAGTTTGCCCGGCAAGTCCACTCCTGGCCGCTCATGGCACCTCGCCAGCTCAGGCGGCCATG
ATGCCGGGAGGTATGAGCACGGTGCAAATCACAGAGGTCCTTGTGCGCTTCCTCCTTGGTTCCTACGGCATGACC
CTTCGCTTCAGCCACTCTGATAATAATGGCTTGCAGTTCAACAGTAGTCTTGCATATGTAGACACCGACACCAAC
TGGTTCTTCACCGAGACGCCGTCCCTACTAGGCAGCATAGCCTTCCTCCGCCACCTTACCCGGAGCCCCCAGCTC
AACCGCGCCGTTGTCGATGTCCTTGAGGGTCAAGCCATTACTATTCTCGTCATTGTCTCCTTTATTCTCGTCATA
CTTGTCCGAGACTATGTAGTGCAGCAGCAGCCAGAGCTGAATCTTCGCGCAGCCTTTGATGCCGCCGAGCATCAA
CTCAACCCCGAGGCTCTTGGGCATCCTCACGCTGCTGCCCCCGCTGAACTTGCGGCCCATCAAGCAGAAGCAGAC
TCTGACGACGAGACTCTGGATGACCAAGGTCAACCCACGAGACCCACGGCAACCGAAGACCAGGCCCAAGAGACT
TCTGATTCCTGGACAGAACAAGATTCTCTCCGTGATTCCTCTAGAGAGCTCGAGAATACTCGTATTCTCATGTCT
TCGCTCTCGTCGGGCTATGACATCTCAAATAGGTCAGGTATAGAGGCCATGGCCTCCAATAGCGCTGACGATGAG
TCGAATCTTGGCCACTATCTTCAGTTGTACCGTCGAGCAGGCGGAGACCGGGAAAGGATATTGGAGATTGTTGAG
GCGGAAGGTCTCGAGGATAAGCTGCACCACTGGGTCGACGTGGCGCAACAGACCATCACTGCAAAGGAAGACATT
GGCCGCAAGTTTGCCGATTTGTTGACTTCCAAGTCAGCTGCAGCATCATATGCATCTCGTCATTTACCAGCAAGA
GGAAATGTTGAGTCGGATAATGGCCCACAACAATTGGATGCTTCAGCTTCCGCTCTCACAGCCCCTGCCATGTCT
GACGATTCATCGCATTCTGGCTCGAGGGAAAAACACAAACAAGTTTGGCCACCTATACCTCAAGTCTCGCCGAGT
CAGCCGCGCCAACGCTCCTCGTCACACGGTCCTCGTCTACAAGCATCGCCATCGCCATCCGACGACGACGTTCGA
TTGGGCTCTGAGTATCTGTTTCCAGACTTTGCCAACAACAGCTCTACTGCAGATGAAGATTCTACCATGACCCTG
GGGCCGCAGGATGCATTGTTGCCTGTTGAGGACGCCCATGGCGAAGCTACACCAGAGATGCAGGTCGCTGGAGAA
GGCGACTTGCAGGTGGAACAACCTCAAGAAGCCGCCATTGTTGATGCAGCTCCGAGCTCTGGAGCCATTGATGAG
GCCTCTGCTAATAGACAGCAAACAGGCTTAACAGGACGTATTGCCGACTTCATGTGGGGCAACCTTGACGAGAAT
CAAAACGCCAACGCAGACGATAATCAAGAAGTTGACGAGGAGGATTTATGGGTCGATGTGCCCATGGGCGAAGAC
CTGGAAGGCGACGATGCAGATGGTGAAAACGGCGGACGCGGGGCTCGAAATGCCGAGGCCCTTGAAGAAATGGAA
GACTTGGAAGACTTTGATGGCGCAATGGAGCTCATTGGCGTCCGTGGGCCCCTTATCGGCCTCTTTCAAAACGCC
ATCTTTTGCTCCATCCTCGTCTCCGTCACGGTGTTTGGCTGCGTCTTTGTGCCCTACAACCTCGGGCGAATCGCA
CTCGTCATTGCCGCCGATCCATTGCAACTGCTTCGCGTCTTGTTGGAATTTTCAAAGATGGCCCAAGATGCTGCC
ATTATGATTGGCGCGCTTGTTTCGTGGTGTTTTCTGAACCTTGTCGATATCGTCACAAGCATCCTCGGCGGAGCT
TTGGGCGCCAAGGTGGTGGTCGCGCGGCGAGCCTCTTGGATGATGTGGACCGGAGCGGGTAACCGCATCTGGGAC
TTTGCCCTCATCACTTTGCCCATGTCTTCCTCCGATCTTCAGAGCTTCTCGGTTCTCAGCCACGAAGCCCTTGTG
GCCGTCAAGAGCGCATTGGCGGCGGGAGTTGGCAGCCTTTATTACAATGTAGCCTCGATACCCTCTCGAGACTTC
CACATTGCCGACGGCAAATTGTTGAGCATCATGTCAGGCTTCATGACGTCGTTGGCTGCCTACATTCAGATGGCT
TTTTCGCTTCTCATCGACCCCAAGTCGTGGGTGATTGACTTGAGCAATAGAATGGAGCCGCGTCCTTCAACCACT
GCCGACGTGGCATGGTCAAATTCAGATCGTTTCTGGGCCATTTTGGCCGGTTACCTGACCATATCTGCCATTGGT
GCCCTGTACCTAAGACGAGGCACGCCATTTTCTCGCAACAACTTGCTCCACGCATGGGAAGCGGGCATTATCGAC
ACTCTGCAACAGGCCAGCGGCATAATCAAGGTCATTTTGGTCATTAGCATCGAGATGCTAGTCTTTCCTCTTTAC
TGCGGCATTCTCCTTGACATTGCTCTGCTGCCTATATTCGAAAATGCGACTATCAAGTCTCGTCTCGTCTTTACC
TACAATTTCCCCCTCACTTCTGCATTCGTTCACTGGTTTGCTGGCACTGGATACATGTTCCATTTTGCCCTTTTT
GTCGCCATGTGTCGCAAGATTGTGCGTCCGGGCGTCTTGTGTAAGCCTTTTGCCATTTTCCGTCGACATGATGCT
CCTGCTAACCATGTACCAGATTTTATCCGAGACCCTGATGACCCTGAATTCCACCCGGTCCGTGACGTGCTTGAA
AGGAGCCTTGCCGCGCAACTAAAAAAGATTTTGTTCTCGGCACTGATATATGGTGCTTTGGTCACTGTTGGGCTT
GGCGGTGTGGTCTGGACATTGTCTTATACCATGCCTGGCATTCTGCCTATACACTACTCCTCAAACGAGCCCGTC
TTGGAATTCCCGGTTGATTTACTATTTTACAACTTCCTCATGCCTTTGGCTGTCAGGATACTCAAGCCAAACGAT
CGACTGCATACTACTTATACCTGGTGGTTCCGTAAATGCGCTCGCTGTCTTCGACTTACCCACTTTCTCTTTGGC
GAGCGGAGAATTGACGAAGAAGGCACATTGCAACTTGCATCAGGGGCCGCTTCCAAGTGGCCGTCGGCCTTTACG
TGGCTCCAGCTGACTGAACGGAATAAAGTGGTGCGCATGACTTGGCGTGACGTTGCCAAAGCCATTAGCGCCGAT
CCAAATTCTCTTCCGCCTGTTGGTGGCGAGGCCATGATGAGACAAAGGAAAAAGGCATTGGTCAAGACACGACAA
CTTGTCAAGAGTGGACGCTTCGTGCGCGCACCCGCAACAGATCGCGTCCGGATCCCAAAGGGAAGACATGTCTTT
CTCGAGGTGTGGGAAACTGGCCAGCACAAGCATGAAAGACCAGAAAACGACTTTTATATGACGGATCAATTCAAG
CTCGTCTATGTTCCGCCCAGTTTCCGCACCAGAATCTTCCTGCTCATCCTTTCCATCTGGCTCTTTGCAGGCATC
ACGGGTATTGGCATAACCGTCGTCCCCCTCGTTTTTGGGCGCGTCTTTTTCAAGGCTCTGATTCCGAGCCATGTT
CGGACAAACGATATTTATGCATTCAGCATTGGCATCTATATTCTTGGCACCCTTGTTTTCTCCGCGCTTAGGATC
CAACGTATCGCCTCGGCTGTTCGAAGCCGGGCTCAAGCAGCATGGAACAACATGACGGCAAGTGGATTGGCTGGA
CGCGTAGCCTCTGAGTTTGTTCGCGCCGTCAAGATTGCATACGCCTATTTTTCAGTCATTGTCGTGGTGCCGCTT
GTGCTCTCCTTGATCATTGAGCTGTACCTTGCCATACCCCTGGATACCTACATGAACCCTCCTGCAACGTTGGCC
TCTGAGGCAACAACAGAAGGGCGCAGCAGCGTTATTGGACCGCAAAAGGCGATTGGTTCTGCATCACATAGCATT
CTTCTCATCCAGGCCTGGACCTTGGGGGTTCTCTACCTTAACCTGGGCTGCAAGATGATACTGTCTCTGGCTCCA
GAGAGTCGCATGGCAATTGCACTAAGGAGCGTTTTGCGCCATGGCTTTCTGCGACCCGACGTTGGAGTTTTGACG
CGCGCCTTTATTATCCCCGCCACTGCTGTGGCGATTATTGCAGCATTTGGGCCGCCACTGCTTGTCAGGATGGCT
TTGGCGCTTGGCAGCTTATTTGGACCTGAGAGCATACCAAGTAGCACAGTCTTGCTGTACAGATATTCCTACCCT
GCTGCTGCTTTGTTTGGACTCGTGGCTCAAGGCGTCATTGGTTTGGGAGGCATCTTGCGGGGATGGAAGACGCGC
ATACGCGATGAGGCCTATTTGATTGGAGAGCGATTGCACAACTTTGGAGCGGCAACAGCAGGATCAAGGACGGCG
AAAAAAGCCTGGGGGGCTGGTAGGCCCCGTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail