Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2420
Gene name
LocationContig_176:21088..22464
Strand-
Gene length (bp)1376
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01731 Arylesterase Arylesterase 2.0E-04 201 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54832|PON2_CANLF Serum paraoxonase/arylesterase 2 OS=Canis lupus familiaris GN=PON2 PE=2 SV=1 109 321 7.0E-14
sp|Q58DS7|PON2_BOVIN Serum paraoxonase/arylesterase 2 OS=Bos taurus GN=PON2 PE=2 SV=1 109 321 2.0E-13
sp|P52430|PON1_MOUSE Serum paraoxonase/arylesterase 1 OS=Mus musculus GN=Pon1 PE=1 SV=2 126 321 5.0E-13
sp|Q62086|PON2_MOUSE Serum paraoxonase/arylesterase 2 OS=Mus musculus GN=Pon2 PE=1 SV=2 103 321 5.0E-13
sp|Q6AXM8|PON2_RAT Serum paraoxonase/arylesterase 2 OS=Rattus norvegicus GN=Pon2 PE=2 SV=1 103 321 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54832|PON2_CANLF Serum paraoxonase/arylesterase 2 OS=Canis lupus familiaris GN=PON2 PE=2 SV=1 109 321 7.0E-14
sp|Q58DS7|PON2_BOVIN Serum paraoxonase/arylesterase 2 OS=Bos taurus GN=PON2 PE=2 SV=1 109 321 2.0E-13
sp|P52430|PON1_MOUSE Serum paraoxonase/arylesterase 1 OS=Mus musculus GN=Pon1 PE=1 SV=2 126 321 5.0E-13
sp|Q62086|PON2_MOUSE Serum paraoxonase/arylesterase 2 OS=Mus musculus GN=Pon2 PE=1 SV=2 103 321 5.0E-13
sp|Q6AXM8|PON2_RAT Serum paraoxonase/arylesterase 2 OS=Rattus norvegicus GN=Pon2 PE=2 SV=1 103 321 2.0E-12
sp|P55159|PON1_RAT Serum paraoxonase/arylesterase 1 OS=Rattus norvegicus GN=Pon1 PE=1 SV=3 126 321 2.0E-12
sp|P27169|PON1_HUMAN Serum paraoxonase/arylesterase 1 OS=Homo sapiens GN=PON1 PE=1 SV=3 109 321 3.0E-12
sp|Q15165|PON2_HUMAN Serum paraoxonase/arylesterase 2 OS=Homo sapiens GN=PON2 PE=1 SV=3 114 321 9.0E-12
sp|Q15166|PON3_HUMAN Serum paraoxonase/lactonase 3 OS=Homo sapiens GN=PON3 PE=1 SV=3 84 319 2.0E-11
sp|Q9BGN0|PON3_RABIT Serum paraoxonase/lactonase 3 OS=Oryctolagus cuniculus GN=PON3 PE=1 SV=1 84 321 5.0E-11
sp|Q90952|PON2_CHICK Serum paraoxonase/arylesterase 2 OS=Gallus gallus GN=PON2 PE=2 SV=1 108 321 6.0E-11
sp|Q91090|PON2_MELGA Serum paraoxonase/arylesterase 2 OS=Meleagris gallopavo GN=PON2 PE=2 SV=1 108 321 7.0E-11
sp|P27170|PON1_RABIT Serum paraoxonase/arylesterase 1 OS=Oryctolagus cuniculus GN=PON1 PE=1 SV=2 126 314 1.0E-10
sp|Q68FP2|PON3_RAT Serum paraoxonase/lactonase 3 OS=Rattus norvegicus GN=Pon3 PE=2 SV=1 39 319 4.0E-10
sp|Q62087|PON3_MOUSE Serum paraoxonase/lactonase 3 OS=Mus musculus GN=Pon3 PE=1 SV=2 42 319 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0004064 arylesterase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0052689 carboxylic ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2420
MASQRSKKTVPALVLLFALAVSYLYGHDLRRASTVWGLFRQRASSPANDFSLIEGTTHCEDVHHHRASNLLFAAC
NNHEPSRYLWFPPVPIFTNATAGFESRGSITVINPTTLQARALRFENFDKTFVPHGIDLVDDPSEAEGRAIFILV
VNHPPNPDFYHRADSSAPMARSVVEVFHHVLASETVSHVRTVRHALIKTPNDILATSPTSFFVTNDHYYTHGLMR
GVEDLVHRAKWSDTVYVEFDASADDAQGVEASVALSGLHNNNGICRGRTADEVLISSATGGELYIGTMYNEGASK
TPNAIKLVETISLDSCVDNPSYFSDPYANQTFDASAYVLGGLSKGIRLILNSDYAAGGFDIAVWKVTPARHGDRD
KAREEQTDRWTKQLLWQDDGSRISTASAAVLVAKEPSANGGRQAQLFVTGFFSRSMAVVTVEL*
Coding >OphauB2|2420
ATGGCTTCTCAACGGTCAAAAAAGACGGTGCCAGCCCTTGTCCTCTTGTTTGCCCTAGCCGTAAGCTACTTGTAT
GGCCATGACCTGCGTCGAGCCAGCACAGTCTGGGGTTTGTTTCGACAACGCGCCTCAAGCCCAGCCAACGACTTT
TCCCTGATAGAGGGAACGACCCATTGCGAGGATGTCCACCATCACCGCGCGAGCAACTTGCTCTTCGCCGCTTGC
AACAATCATGAGCCCTCTAGGTACTTGTGGTTTCCGCCGGTGCCAATCTTTACCAATGCCACTGCTGGCTTCGAG
TCCCGAGGAAGCATAACTGTCATTAATCCCACGACTCTGCAAGCTCGGGCGCTGCGCTTTGAAAACTTTGACAAG
ACCTTTGTGCCACATGGAATCGACCTTGTCGACGACCCAAGTGAAGCAGAGGGCAGGGCCATCTTCATACTCGTC
GTCAACCACCCTCCCAACCCCGACTTTTACCACAGGGCCGACTCGAGCGCTCCCATGGCGCGGTCCGTCGTCGAA
GTCTTTCACCATGTGCTTGCATCTGAGACGGTTAGCCACGTGCGAACTGTGCGGCATGCCCTCATCAAAACACCA
AACGATATCCTGGCAACATCGCCAACGTCCTTTTTTGTCACCAACGACCACTATTATACCCATGGCCTGATGCGA
GGCGTGGAGGATCTAGTGCACAGAGCAAAGTGGTCTGATACTGTGTACGTCGAGTTTGACGCCTCGGCAGACGAC
GCTCAAGGAGTCGAGGCCTCAGTCGCTCTGAGCGGCCTCCACAACAACAACGGCATATGCCGGGGCCGCACGGCG
GACGAAGTGCTCATTAGCAGTGCCACGGGCGGCGAGCTGTATATTGGAACCATGTACAACGAGGGAGCCAGCAAG
ACGCCCAATGCCATCAAGCTTGTCGAGACAATCAGCCTGGACTCTTGCGTGGATAATCCAAGCTACTTTAGCGAT
CCCTACGCCAACCAAACGTTTGACGCCAGCGCATATGTGCTGGGCGGACTGTCCAAGGGCATCAGACTCATACTC
AACTCCGACTATGCTGCTGGTGGCTTTGACATTGCGGTGTGGAAGGTGACGCCCGCCAGGCACGGGGACCGCGAC
AAGGCCAGAGAGGAGCAGACTGACAGATGGACCAAGCAGCTGCTATGGCAAGACGACGGCTCGCGCATCAGCACC
GCAAGCGCTGCCGTCTTGGTGGCCAAGGAGCCGAGTGCCAATGGTGGCCGTCAGGCACAGCTCTTTGTGACGGGC
TTCTTCTCCAGGAGCATGGCTGTTGTCACGGTTGAGCTGTGA
Transcript >OphauB2|2420
ATGGCTTCTCAACGGTCAAAAAAGACGGTGCCAGCCCTTGTCCTCTTGTTTGCCCTAGCCGTAAGCTACTTGTAT
GGCCATGACCTGCGTCGAGCCAGCACAGTCTGGGGTTTGTTTCGACAACGCGCCTCAAGCCCAGCCAACGACTTT
TCCCTGATAGAGGGAACGACCCATTGCGAGGATGTCCACCATCACCGCGCGAGCAACTTGCTCTTCGCCGCTTGC
AACAATCATGAGCCCTCTAGGTACTTGTGGTTTCCGCCGGTGCCAATCTTTACCAATGCCACTGCTGGCTTCGAG
TCCCGAGGAAGCATAACTGTCATTAATCCCACGACTCTGCAAGCTCGGGCGCTGCGCTTTGAAAACTTTGACAAG
ACCTTTGTGCCACATGGAATCGACCTTGTCGACGACCCAAGTGAAGCAGAGGGCAGGGCCATCTTCATACTCGTC
GTCAACCACCCTCCCAACCCCGACTTTTACCACAGGGCCGACTCGAGCGCTCCCATGGCGCGGTCCGTCGTCGAA
GTCTTTCACCATGTGCTTGCATCTGAGACGGTTAGCCACGTGCGAACTGTGCGGCATGCCCTCATCAAAACACCA
AACGATATCCTGGCAACATCGCCAACGTCCTTTTTTGTCACCAACGACCACTATTATACCCATGGCCTGATGCGA
GGCGTGGAGGATCTAGTGCACAGAGCAAAGTGGTCTGATACTGTGTACGTCGAGTTTGACGCCTCGGCAGACGAC
GCTCAAGGAGTCGAGGCCTCAGTCGCTCTGAGCGGCCTCCACAACAACAACGGCATATGCCGGGGCCGCACGGCG
GACGAAGTGCTCATTAGCAGTGCCACGGGCGGCGAGCTGTATATTGGAACCATGTACAACGAGGGAGCCAGCAAG
ACGCCCAATGCCATCAAGCTTGTCGAGACAATCAGCCTGGACTCTTGCGTGGATAATCCAAGCTACTTTAGCGAT
CCCTACGCCAACCAAACGTTTGACGCCAGCGCATATGTGCTGGGCGGACTGTCCAAGGGCATCAGACTCATACTC
AACTCCGACTATGCTGCTGGTGGCTTTGACATTGCGGTGTGGAAGGTGACGCCCGCCAGGCACGGGGACCGCGAC
AAGGCCAGAGAGGAGCAGACTGACAGATGGACCAAGCAGCTGCTATGGCAAGACGACGGCTCGCGCATCAGCACC
GCAAGCGCTGCCGTCTTGGTGGCCAAGGAGCCGAGTGCCAATGGTGGCCGTCAGGCACAGCTCTTTGTGACGGGC
TTCTTCTCCAGGAGCATGGCTGTTGTCACGGTTGAGCTGTGA
Gene >OphauB2|2420
ATGGCTTCTCAACGGTCAAAAAAGACGGTGCCAGCCCTTGTCCTCTTGTTTGCCCTAGCCGTAAGCTACTTGTAT
GGCCATGACCTGCGTCGAGCCAGCACAGTCTGGGGTTTGTTTCGACAACGCGCCTCAAGCCCAGCCAACGACTTT
TCCCTGATAGAGGGAACGACCCATTGCGAGGATGTCCACCATCACCGCGCGAGCAACTTGCTCTTCGCCGCTTGC
AACAATCATGAGCCCTCTAGGTACTTGTGGTTTCCGCCGGTGCCAATCTTTACCAATGCCACTGCTGGCTTCGAG
TCCCGAGGAAGCATAACTGTCATTAATCCCACGGTATGGTATTGAATATCCCGCTCCCCAGCCCCCGGCTCGCTG
TGCTCAACCAGGTCTAGACTCTGCAAGCTCGGGCGCTGCGCTTTGAAAACTTTGACAAGACCTTTGTGCCACATG
GAATCGACCTTGTCGACGACCCAAGTGAAGCAGAGGGCAGGGCCATCTTCATACTCGTCGTCAACCACCCTCCCA
ACCCCGACTTTTACCACAGGGCCGACTCGAGCGCTCCCATGGCGCGGTCCGTCGTCGAAGTCTTTCACCATGTGC
TTGCATCTGAGACGGTTAGCCACGTGCGAACTGTGCGGCATGCCCTCATCAAAACACCAAACGATATCCTGGCAA
CATCGCCAACGTCCTTTTTTGTCACCAACGACCACTATTATACCCATGGCCTGATGCGAGGCGTGGAGGATCTAG
TGCACAGAGCAAAGTGGTCTGATACTGTGTACGTCGAGTTTGACGCCTCGGCAGACGACGCTCAAGGAGTCGAGG
CCTCAGTCGCTCTGAGCGGCCTCCACAACAACAACGGCATATGCCGGGGCCGCACGGCGGACGAAGTGCTCATTA
GCAGTGCCACGGGCGGCGAGCTGTATATTGGAACCATGTACAACGAGGGAGCCAGCAAGACGCCCAATGCCATCA
AGCTTGTCGAGACAATCAGCCTGGACTCTTGCGTGGATAATCCAAGCTACTTTAGCGATCCCTACGCCAACCAAA
CGTTTGACGCCAGCGCATATGTGCTGGGCGGACTGTCCAAGGGCATCAGACTCATACTCAACTCCGACTATGCTG
CTGGTGGCTTTGACATTGCGGTGTGGAAGGTGACGCCCGCCAGGCACGGGGACCGCGACAAGGCCAGAGAGGAGC
AGACTGACAGATGGACCAAGCAGCTGCTATGGCAAGACGACGGCTCGCGCATCAGCACCGCAAGCGCTGCCGTCT
TGGTGGCCAAGGAGCCGAGTGCCAATGGTGGCCGTCAGGCACAGCTCTTTGTGACGGGCTTCTTCTCCAGGAGCA
TGGCTGTTGTCACGGTTGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail