Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2413
Gene name
LocationContig_176:1310..4544
Strand-
Gene length (bp)3234
Transcript length (bp)3234
Coding sequence length (bp)3234
Protein length (aa) 1078

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9QYX7|PCLO_MOUSE Protein piccolo OS=Mus musculus GN=Pclo PE=1 SV=4 921 1037 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2413
MKGVLVLGALAAGVARANQFPECEQDNCYRNLIDDRFKDAASHFCFDFLAGTTTAASAIPTDFNNCDGQVDKVSS
ACSCITYSATQTDSPTSPTSPPEQTAYPPPGNSYYYPPPGDSDYPPPDSVYVPPVPGTSQPGASTPASETPTTSD
SVIPSTPGTSETANPTVPSETIVIPTLPSESGPVPSVTDVTPVTPSVPGTNPTSEAPSTDSEVPSSPALPTPTFP
SLTYDTSVYYPAPGTSEAPSSSGPVVPGSSSSVPQLPTSDVLPTTPSESETPSITGPILPPGTSLTLSFPDTSLP
GTSEASSGPSTESHGPSSSAPGSETASIPGSETQGSSTVPSSASAPETQTASETPSGSVPSTGTAPETPTSAASE
STGWTTSTVYTSKTYVVTRCASTVPNCPGGHITTVTETVPVSTTVCPVTETLVPSVSVPETPSVSVPETETEAPT
TAPLTPSVSVPETETETEVPTSGPATEGPTASHTSSVSVPETETETEVPTSGPATEGPTASHTPSVSVPETETET
EVPGTSSGVETGSQPYSVPASSTETANPTTPGVPTATVSVPESSGPVVPTGTASVPESSGPVVPTGTASVPESSG
PAVPTGTASVPESSGPVVPTGTYSAPESSGPVVPTGTASVPESSGPVVPTVPTGTASVPESSGPIVPTGTASVPE
SSGPAVPTVPTGTASVPESSIPGVPTFSISFPHSSAPGIPTASQPVYPTPELPSTHVNYPTSEETNNPTSPPEGT
TTRYTTSTIHATLTHTLTRCSANMPSCPGSSIVTVITETVPVSTTVCPVTQHPTDVPSQQPSSYPQPPASEPLPV
NTDTSTQYMTQTYTITSCAPNVPNCPIGSVSTTVYPTPVVSITGSFTSIIRSPSAVPQPTDVAPLPPVLPTGVPQ
PSVLPSVGPTGQPQPSYYPPPAQSGPGKQPSVQPQPPVQPTEKPQPGQPQPPVQPTGQPQPEKPEPEQPEKPEPE
QPEKPEPEQPEKPEPEQPEKPEPEQPEKPEPEQPEPEQPGKPQPQPIYPIPGQSSAQAPNPTYGLRPTSTSTSNP
VVITAAASRLINSANAAIFVAGLIALL*
Coding >OphauB2|2413
ATGAAGGGCGTCTTGGTTCTGGGCGCCCTGGCTGCCGGCGTGGCCCGCGCAAACCAGTTCCCAGAGTGCGAGCAA
GACAACTGCTACCGCAACCTCATCGACGACCGCTTCAAGGACGCGGCCTCGCACTTTTGCTTCGACTTTCTGGCT
GGCACCACCACGGCCGCCTCGGCCATCCCTACAGACTTTAACAACTGCGATGGCCAGGTAGACAAGGTCAGCTCG
GCCTGCTCTTGCATCACCTACTCGGCAACACAAACCGACAGCCCGACCTCGCCCACCTCGCCCCCTGAGCAGACG
GCCTACCCCCCTCCGGGCAACTCGTACTACTATCCGCCCCCTGGAGACTCGGACTACCCTCCGCCCGACTCGGTC
TATGTGCCGCCCGTGCCCGGCACCAGCCAGCCCGGAGCCTCCACTCCCGCCTCGGAGACACCTACTACCTCTGAC
TCGGTCATTCCCAGCACGCCTGGAACCAGCGAGACGGCCAATCCCACCGTCCCCTCAGAGACCATTGTTATCCCT
ACTCTCCCCTCGGAGTCTGGCCCAGTGCCTTCTGTCACCGATGTCACTCCAGTGACGCCGTCGGTGCCGGGAACA
AATCCTACCAGCGAAGCTCCCTCTACCGACTCCGAGGTGCCCAGCTCTCCGGCGCTGCCAACGCCCACCTTTCCT
TCTCTGACCTATGACACCTCGGTCTACTACCCGGCGCCCGGCACCAGCGAGGCTCCGTCTTCGTCTGGGCCTGTC
GTGCCGGGCTCGAGCTCCTCGGTGCCCCAGCTCCCTACCTCTGATGTGCTGCCCACCACTCCCTCTGAGAGCGAG
ACTCCCTCCATCACTGGCCCCATTCTGCCCCCTGGCACTTCTCTTACTCTGTCCTTCCCTGACACTTCTTTGCCC
GGCACCAGTGAGGCTTCTTCTGGCCCCAGCACTGAGTCCCATGGCCCCTCAAGCTCGGCTCCAGGAAGCGAGACG
GCCTCTATCCCTGGCTCTGAGACCCAGGGCTCCTCCACCGTCCCTAGCTCTGCCTCTGCTCCCGAGACCCAGACT
GCATCAGAGACTCCATCTGGCTCTGTTCCCAGCACTGGCACTGCTCCTGAGACGCCCACAAGTGCCGCGTCAGAG
TCGACTGGATGGACCACTTCCACCGTCTACACGAGCAAGACTTATGTTGTCACGCGTTGTGCCTCGACTGTCCCC
AACTGCCCTGGCGGCCACATCACCACTGTGACAGAGACAGTGCCAGTGTCTACCACCGTGTGCCCTGTGACGGAG
ACGCTGGTGCCTTCGGTGTCGGTTCCCGAAACGCCCTCGGTCTCTGTACCCGAGACTGAGACAGAGGCTCCTACT
ACTGCTCCTCTCACGCCTTCAGTCTCTGTTCCTGAGACGGAGACAGAGACTGAGGTGCCCACCTCGGGTCCTGCT
ACTGAAGGGCCTACTGCTTCTCACACGTCTTCAGTCTCTGTGCCCGAGACTGAGACCGAGACTGAGGTGCCTACC
TCGGGTCCTGCTACTGAAGGACCTACTGCTTCTCACACACCTTCAGTCTCTGTGCCCGAGACTGAGACCGAGACC
GAGGTGCCTGGTACCTCGTCGGGCGTTGAGACTGGCAGTCAGCCATACTCTGTGCCAGCGTCCTCCACTGAGACT
GCGAATCCAACTACACCTGGCGTCCCCACTGCCACTGTCTCGGTGCCAGAGTCGTCTGGCCCTGTTGTCCCTACG
GGAACTGCTTCGGTGCCAGAGTCGTCTGGCCCTGTTGTCCCTACGGGAACTGCTTCGGTGCCAGAGTCGTCTGGC
CCTGCTGTCCCAACGGGAACTGCCTCTGTTCCAGAGTCGTCTGGTCCCGTTGTTCCCACTGGGACATACTCTGCT
CCTGAGTCTTCTGGCCCTGTCGTTCCCACTGGAACTGCTTCAGTTCCCGAGTCTTCTGGCCCTGTCGTTCCTACT
GTCCCTACTGGCACAGCTTCAGTTCCCGAGTCGTCTGGCCCTATCGTTCCTACTGGCACAGCTTCAGTTCCCGAG
TCTTCTGGCCCTGCCGTCCCTACTGTCCCTACTGGCACTGCTTCAGTTCCCGAGTCCTCCATTCCTGGAGTCCCT
ACCTTCTCCATCTCTTTCCCACACTCATCTGCTCCCGGGATCCCTACGGCCTCCCAGCCCGTATACCCAACCCCT
GAGTTGCCGAGCACCCATGTCAATTATCCAACCTCGGAGGAAACAAACAATCCTACCAGCCCGCCCGAAGGCACC
ACCACTCGGTATACGACTTCAACTATCCATGCAACGCTCACTCACACTCTGACGAGGTGCTCGGCCAACATGCCC
AGCTGCCCCGGCAGCAGCATTGTTACTGTCATCACTGAGACTGTTCCCGTGTCGACGACTGTCTGCCCTGTCACT
CAGCATCCCACCGATGTGCCATCGCAACAGCCCAGCAGCTATCCCCAGCCGCCCGCGTCGGAGCCTCTGCCCGTC
AACACCGACACATCTACTCAGTACATGACACAGACATACACCATTACCTCTTGCGCTCCTAATGTGCCCAACTGC
CCTATTGGCAGCGTCAGCACTACTGTCTATCCTACACCCGTCGTGTCCATCACGGGCTCCTTTACTTCTATTATT
CGCTCGCCCTCGGCCGTCCCTCAGCCTACTGACGTTGCCCCGCTGCCGCCTGTGTTGCCCACGGGCGTTCCTCAG
CCATCAGTCCTGCCGTCGGTAGGCCCTACGGGTCAGCCGCAGCCGTCCTACTACCCGCCGCCGGCTCAGTCTGGC
CCTGGAAAGCAGCCGTCAGTGCAGCCCCAGCCGCCTGTTCAGCCTACTGAGAAGCCTCAGCCTGGACAGCCCCAA
CCGCCTGTTCAACCTACTGGACAACCCCAACCCGAGAAGCCTGAGCCTGAACAGCCTGAAAAGCCTGAGCCTGAA
CAGCCAGAGAAACCAGAGCCTGAACAGCCTGAAAAGCCTGAGCCTGAACAGCCAGAGAAACCAGAGCCTGAACAG
CCAGAGAAGCCTGAGCCCGAACAGCCTGAGCCTGAGCAGCCAGGCAAGCCTCAACCTCAGCCCATCTATCCCATC
CCGGGTCAGTCTTCAGCCCAGGCTCCCAACCCAACATATGGCCTGCGTCCCACGTCGACGTCTACCTCCAACCCC
GTCGTCATTACAGCCGCTGCCAGTCGTCTCATCAACAGTGCCAATGCCGCAATCTTTGTGGCCGGTCTTATTGCC
CTGTTGTAG
Transcript >OphauB2|2413
ATGAAGGGCGTCTTGGTTCTGGGCGCCCTGGCTGCCGGCGTGGCCCGCGCAAACCAGTTCCCAGAGTGCGAGCAA
GACAACTGCTACCGCAACCTCATCGACGACCGCTTCAAGGACGCGGCCTCGCACTTTTGCTTCGACTTTCTGGCT
GGCACCACCACGGCCGCCTCGGCCATCCCTACAGACTTTAACAACTGCGATGGCCAGGTAGACAAGGTCAGCTCG
GCCTGCTCTTGCATCACCTACTCGGCAACACAAACCGACAGCCCGACCTCGCCCACCTCGCCCCCTGAGCAGACG
GCCTACCCCCCTCCGGGCAACTCGTACTACTATCCGCCCCCTGGAGACTCGGACTACCCTCCGCCCGACTCGGTC
TATGTGCCGCCCGTGCCCGGCACCAGCCAGCCCGGAGCCTCCACTCCCGCCTCGGAGACACCTACTACCTCTGAC
TCGGTCATTCCCAGCACGCCTGGAACCAGCGAGACGGCCAATCCCACCGTCCCCTCAGAGACCATTGTTATCCCT
ACTCTCCCCTCGGAGTCTGGCCCAGTGCCTTCTGTCACCGATGTCACTCCAGTGACGCCGTCGGTGCCGGGAACA
AATCCTACCAGCGAAGCTCCCTCTACCGACTCCGAGGTGCCCAGCTCTCCGGCGCTGCCAACGCCCACCTTTCCT
TCTCTGACCTATGACACCTCGGTCTACTACCCGGCGCCCGGCACCAGCGAGGCTCCGTCTTCGTCTGGGCCTGTC
GTGCCGGGCTCGAGCTCCTCGGTGCCCCAGCTCCCTACCTCTGATGTGCTGCCCACCACTCCCTCTGAGAGCGAG
ACTCCCTCCATCACTGGCCCCATTCTGCCCCCTGGCACTTCTCTTACTCTGTCCTTCCCTGACACTTCTTTGCCC
GGCACCAGTGAGGCTTCTTCTGGCCCCAGCACTGAGTCCCATGGCCCCTCAAGCTCGGCTCCAGGAAGCGAGACG
GCCTCTATCCCTGGCTCTGAGACCCAGGGCTCCTCCACCGTCCCTAGCTCTGCCTCTGCTCCCGAGACCCAGACT
GCATCAGAGACTCCATCTGGCTCTGTTCCCAGCACTGGCACTGCTCCTGAGACGCCCACAAGTGCCGCGTCAGAG
TCGACTGGATGGACCACTTCCACCGTCTACACGAGCAAGACTTATGTTGTCACGCGTTGTGCCTCGACTGTCCCC
AACTGCCCTGGCGGCCACATCACCACTGTGACAGAGACAGTGCCAGTGTCTACCACCGTGTGCCCTGTGACGGAG
ACGCTGGTGCCTTCGGTGTCGGTTCCCGAAACGCCCTCGGTCTCTGTACCCGAGACTGAGACAGAGGCTCCTACT
ACTGCTCCTCTCACGCCTTCAGTCTCTGTTCCTGAGACGGAGACAGAGACTGAGGTGCCCACCTCGGGTCCTGCT
ACTGAAGGGCCTACTGCTTCTCACACGTCTTCAGTCTCTGTGCCCGAGACTGAGACCGAGACTGAGGTGCCTACC
TCGGGTCCTGCTACTGAAGGACCTACTGCTTCTCACACACCTTCAGTCTCTGTGCCCGAGACTGAGACCGAGACC
GAGGTGCCTGGTACCTCGTCGGGCGTTGAGACTGGCAGTCAGCCATACTCTGTGCCAGCGTCCTCCACTGAGACT
GCGAATCCAACTACACCTGGCGTCCCCACTGCCACTGTCTCGGTGCCAGAGTCGTCTGGCCCTGTTGTCCCTACG
GGAACTGCTTCGGTGCCAGAGTCGTCTGGCCCTGTTGTCCCTACGGGAACTGCTTCGGTGCCAGAGTCGTCTGGC
CCTGCTGTCCCAACGGGAACTGCCTCTGTTCCAGAGTCGTCTGGTCCCGTTGTTCCCACTGGGACATACTCTGCT
CCTGAGTCTTCTGGCCCTGTCGTTCCCACTGGAACTGCTTCAGTTCCCGAGTCTTCTGGCCCTGTCGTTCCTACT
GTCCCTACTGGCACAGCTTCAGTTCCCGAGTCGTCTGGCCCTATCGTTCCTACTGGCACAGCTTCAGTTCCCGAG
TCTTCTGGCCCTGCCGTCCCTACTGTCCCTACTGGCACTGCTTCAGTTCCCGAGTCCTCCATTCCTGGAGTCCCT
ACCTTCTCCATCTCTTTCCCACACTCATCTGCTCCCGGGATCCCTACGGCCTCCCAGCCCGTATACCCAACCCCT
GAGTTGCCGAGCACCCATGTCAATTATCCAACCTCGGAGGAAACAAACAATCCTACCAGCCCGCCCGAAGGCACC
ACCACTCGGTATACGACTTCAACTATCCATGCAACGCTCACTCACACTCTGACGAGGTGCTCGGCCAACATGCCC
AGCTGCCCCGGCAGCAGCATTGTTACTGTCATCACTGAGACTGTTCCCGTGTCGACGACTGTCTGCCCTGTCACT
CAGCATCCCACCGATGTGCCATCGCAACAGCCCAGCAGCTATCCCCAGCCGCCCGCGTCGGAGCCTCTGCCCGTC
AACACCGACACATCTACTCAGTACATGACACAGACATACACCATTACCTCTTGCGCTCCTAATGTGCCCAACTGC
CCTATTGGCAGCGTCAGCACTACTGTCTATCCTACACCCGTCGTGTCCATCACGGGCTCCTTTACTTCTATTATT
CGCTCGCCCTCGGCCGTCCCTCAGCCTACTGACGTTGCCCCGCTGCCGCCTGTGTTGCCCACGGGCGTTCCTCAG
CCATCAGTCCTGCCGTCGGTAGGCCCTACGGGTCAGCCGCAGCCGTCCTACTACCCGCCGCCGGCTCAGTCTGGC
CCTGGAAAGCAGCCGTCAGTGCAGCCCCAGCCGCCTGTTCAGCCTACTGAGAAGCCTCAGCCTGGACAGCCCCAA
CCGCCTGTTCAACCTACTGGACAACCCCAACCCGAGAAGCCTGAGCCTGAACAGCCTGAAAAGCCTGAGCCTGAA
CAGCCAGAGAAACCAGAGCCTGAACAGCCTGAAAAGCCTGAGCCTGAACAGCCAGAGAAACCAGAGCCTGAACAG
CCAGAGAAGCCTGAGCCCGAACAGCCTGAGCCTGAGCAGCCAGGCAAGCCTCAACCTCAGCCCATCTATCCCATC
CCGGGTCAGTCTTCAGCCCAGGCTCCCAACCCAACATATGGCCTGCGTCCCACGTCGACGTCTACCTCCAACCCC
GTCGTCATTACAGCCGCTGCCAGTCGTCTCATCAACAGTGCCAATGCCGCAATCTTTGTGGCCGGTCTTATTGCC
CTGTTGTAG
Gene >OphauB2|2413
ATGAAGGGCGTCTTGGTTCTGGGCGCCCTGGCTGCCGGCGTGGCCCGCGCAAACCAGTTCCCAGAGTGCGAGCAA
GACAACTGCTACCGCAACCTCATCGACGACCGCTTCAAGGACGCGGCCTCGCACTTTTGCTTCGACTTTCTGGCT
GGCACCACCACGGCCGCCTCGGCCATCCCTACAGACTTTAACAACTGCGATGGCCAGGTAGACAAGGTCAGCTCG
GCCTGCTCTTGCATCACCTACTCGGCAACACAAACCGACAGCCCGACCTCGCCCACCTCGCCCCCTGAGCAGACG
GCCTACCCCCCTCCGGGCAACTCGTACTACTATCCGCCCCCTGGAGACTCGGACTACCCTCCGCCCGACTCGGTC
TATGTGCCGCCCGTGCCCGGCACCAGCCAGCCCGGAGCCTCCACTCCCGCCTCGGAGACACCTACTACCTCTGAC
TCGGTCATTCCCAGCACGCCTGGAACCAGCGAGACGGCCAATCCCACCGTCCCCTCAGAGACCATTGTTATCCCT
ACTCTCCCCTCGGAGTCTGGCCCAGTGCCTTCTGTCACCGATGTCACTCCAGTGACGCCGTCGGTGCCGGGAACA
AATCCTACCAGCGAAGCTCCCTCTACCGACTCCGAGGTGCCCAGCTCTCCGGCGCTGCCAACGCCCACCTTTCCT
TCTCTGACCTATGACACCTCGGTCTACTACCCGGCGCCCGGCACCAGCGAGGCTCCGTCTTCGTCTGGGCCTGTC
GTGCCGGGCTCGAGCTCCTCGGTGCCCCAGCTCCCTACCTCTGATGTGCTGCCCACCACTCCCTCTGAGAGCGAG
ACTCCCTCCATCACTGGCCCCATTCTGCCCCCTGGCACTTCTCTTACTCTGTCCTTCCCTGACACTTCTTTGCCC
GGCACCAGTGAGGCTTCTTCTGGCCCCAGCACTGAGTCCCATGGCCCCTCAAGCTCGGCTCCAGGAAGCGAGACG
GCCTCTATCCCTGGCTCTGAGACCCAGGGCTCCTCCACCGTCCCTAGCTCTGCCTCTGCTCCCGAGACCCAGACT
GCATCAGAGACTCCATCTGGCTCTGTTCCCAGCACTGGCACTGCTCCTGAGACGCCCACAAGTGCCGCGTCAGAG
TCGACTGGATGGACCACTTCCACCGTCTACACGAGCAAGACTTATGTTGTCACGCGTTGTGCCTCGACTGTCCCC
AACTGCCCTGGCGGCCACATCACCACTGTGACAGAGACAGTGCCAGTGTCTACCACCGTGTGCCCTGTGACGGAG
ACGCTGGTGCCTTCGGTGTCGGTTCCCGAAACGCCCTCGGTCTCTGTACCCGAGACTGAGACAGAGGCTCCTACT
ACTGCTCCTCTCACGCCTTCAGTCTCTGTTCCTGAGACGGAGACAGAGACTGAGGTGCCCACCTCGGGTCCTGCT
ACTGAAGGGCCTACTGCTTCTCACACGTCTTCAGTCTCTGTGCCCGAGACTGAGACCGAGACTGAGGTGCCTACC
TCGGGTCCTGCTACTGAAGGACCTACTGCTTCTCACACACCTTCAGTCTCTGTGCCCGAGACTGAGACCGAGACC
GAGGTGCCTGGTACCTCGTCGGGCGTTGAGACTGGCAGTCAGCCATACTCTGTGCCAGCGTCCTCCACTGAGACT
GCGAATCCAACTACACCTGGCGTCCCCACTGCCACTGTCTCGGTGCCAGAGTCGTCTGGCCCTGTTGTCCCTACG
GGAACTGCTTCGGTGCCAGAGTCGTCTGGCCCTGTTGTCCCTACGGGAACTGCTTCGGTGCCAGAGTCGTCTGGC
CCTGCTGTCCCAACGGGAACTGCCTCTGTTCCAGAGTCGTCTGGTCCCGTTGTTCCCACTGGGACATACTCTGCT
CCTGAGTCTTCTGGCCCTGTCGTTCCCACTGGAACTGCTTCAGTTCCCGAGTCTTCTGGCCCTGTCGTTCCTACT
GTCCCTACTGGCACAGCTTCAGTTCCCGAGTCGTCTGGCCCTATCGTTCCTACTGGCACAGCTTCAGTTCCCGAG
TCTTCTGGCCCTGCCGTCCCTACTGTCCCTACTGGCACTGCTTCAGTTCCCGAGTCCTCCATTCCTGGAGTCCCT
ACCTTCTCCATCTCTTTCCCACACTCATCTGCTCCCGGGATCCCTACGGCCTCCCAGCCCGTATACCCAACCCCT
GAGTTGCCGAGCACCCATGTCAATTATCCAACCTCGGAGGAAACAAACAATCCTACCAGCCCGCCCGAAGGCACC
ACCACTCGGTATACGACTTCAACTATCCATGCAACGCTCACTCACACTCTGACGAGGTGCTCGGCCAACATGCCC
AGCTGCCCCGGCAGCAGCATTGTTACTGTCATCACTGAGACTGTTCCCGTGTCGACGACTGTCTGCCCTGTCACT
CAGCATCCCACCGATGTGCCATCGCAACAGCCCAGCAGCTATCCCCAGCCGCCCGCGTCGGAGCCTCTGCCCGTC
AACACCGACACATCTACTCAGTACATGACACAGACATACACCATTACCTCTTGCGCTCCTAATGTGCCCAACTGC
CCTATTGGCAGCGTCAGCACTACTGTCTATCCTACACCCGTCGTGTCCATCACGGGCTCCTTTACTTCTATTATT
CGCTCGCCCTCGGCCGTCCCTCAGCCTACTGACGTTGCCCCGCTGCCGCCTGTGTTGCCCACGGGCGTTCCTCAG
CCATCAGTCCTGCCGTCGGTAGGCCCTACGGGTCAGCCGCAGCCGTCCTACTACCCGCCGCCGGCTCAGTCTGGC
CCTGGAAAGCAGCCGTCAGTGCAGCCCCAGCCGCCTGTTCAGCCTACTGAGAAGCCTCAGCCTGGACAGCCCCAA
CCGCCTGTTCAACCTACTGGACAACCCCAACCCGAGAAGCCTGAGCCTGAACAGCCTGAAAAGCCTGAGCCTGAA
CAGCCAGAGAAACCAGAGCCTGAACAGCCTGAAAAGCCTGAGCCTGAACAGCCAGAGAAACCAGAGCCTGAACAG
CCAGAGAAGCCTGAGCCCGAACAGCCTGAGCCTGAGCAGCCAGGCAAGCCTCAACCTCAGCCCATCTATCCCATC
CCGGGTCAGTCTTCAGCCCAGGCTCCCAACCCAACATATGGCCTGCGTCCCACGTCGACGTCTACCTCCAACCCC
GTCGTCATTACAGCCGCTGCCAGTCGTCTCATCAACAGTGCCAATGCCGCAATCTTTGTGGCCGGTCTTATTGCC
CTGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail