Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2411
Gene name
LocationContig_175:36168..38325
Strand+
Gene length (bp)2157
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.1E-08 139 330
PF00083 Sugar_tr Sugar (and other) transporter 7.9E-15 388 575

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 112 570 1.0E-40
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 125 572 1.0E-40
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 125 540 2.0E-40
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 125 540 4.0E-40
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 114 573 6.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 112 570 1.0E-40
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 125 572 1.0E-40
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 125 540 2.0E-40
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 125 540 4.0E-40
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 114 573 6.0E-40
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 125 572 1.0E-39
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 125 574 3.0E-37
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 125 570 4.0E-37
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 125 572 2.0E-36
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 125 572 4.0E-36
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 111 597 4.0E-36
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 125 570 4.0E-36
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 125 574 1.0E-35
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 125 570 3.0E-35
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 123 572 5.0E-35
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 125 570 1.0E-34
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 125 574 2.0E-34
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 125 570 1.0E-33
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 125 572 1.0E-33
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 125 570 1.0E-31
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 125 572 3.0E-31
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 125 515 1.0E-30
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 125 569 1.0E-30
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 182 570 4.0E-30
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 348 574 2.0E-26
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 121 528 5.0E-26
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 342 573 1.0E-25
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 378 573 2.0E-25
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 378 573 7.0E-21
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 131 578 2.0E-18
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 126 579 9.0E-17
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 127 332 2.0E-09
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 127 332 2.0E-08
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 96 303 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 125 147 22
2 173 195 22
3 202 224 22
4 229 251 22
5 281 303 22
6 318 338 20
7 374 393 19
8 416 438 22
9 451 470 19
10 514 536 22
11 543 565 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2411
MTAARDIDSSSSTSSEIHHDHHHHHRHHHHHQRPIPGEVPVPHGPCGDHDSDDLAMAGISPDERRIFAHVTRPDD
SYTPDGVYWADLPLSRRIKFVSQLDRSAASQEVHTIGRMMKRDPLSPVGWYFRHAVIPGAGLGLEGYVLFSIGNL
EPLFKQVWPDCWQTHTVCSKNWVASVTYFEIIGIMVGQAVVGVLGDWIGRRWGLIQDALIMFIGLLMLTASWGLD
QQGWVICYACSLFFYSVGVGGEYPITATSSLESAATAGKLSTREDRLHRGRRVTTAFLMQGWGQFVNQVVLIVLL
VIFNSGRGGPPYSTSAAQYTYRLSFAIPAIGTAWLAYYRTWKMPSASKKLAEAKSRSNVSGYDFNALRYCYAHFG
GRLLATAGTWFCNDVFFYGNKLFQGQFIKVISNNPKSLMTSWTWSLVNIVVSLAGYYLASFLIDNKLYGRKMMQQ
LGFFMCFLMFVIPAFNYEYYTSPGGIHAFQAMYFLSSFFNQFGPNSVTFLVAGEVFPTPVRATAHGFSACIGKSG
ALLASVLYNYIGDQTKFYVVPWFGLAGMLLTLVFLPDTTGLDLKEQERRWNYICQGKASDYHGVAVNPAHLSLWE
RMRGIGKTYDPELDWKAKIEDMRAEWEMVQASRGPKETEDNADHGMPDDGEFSPEIHQYFQRSSPKKLQPNAVMS
EKAVSHT*
Coding >OphauB2|2411
ATGACGGCTGCACGCGATATCGACTCGTCGTCGTCGACGTCGTCGGAAATTCACCATGACCACCACCACCACCAC
CGCCACCACCACCACCATCAACGCCCAATCCCCGGCGAGGTGCCTGTGCCTCATGGTCCCTGCGGCGACCATGAC
AGCGACGACTTGGCCATGGCGGGCATCAGCCCCGATGAGCGTCGCATATTTGCCCATGTGACGCGTCCCGACGAC
TCGTACACACCAGACGGCGTCTACTGGGCCGATCTGCCTCTGTCGCGCCGCATCAAGTTTGTCTCGCAGCTCGAC
CGCAGCGCCGCGTCGCAAGAAGTGCACACAATTGGGCGCATGATGAAGCGCGATCCCCTATCGCCCGTTGGCTGG
TACTTTCGCCATGCCGTCATCCCCGGCGCTGGCCTCGGCCTGGAAGGCTATGTTCTCTTCTCAATTGGCAATCTC
GAGCCGCTCTTCAAGCAAGTATGGCCAGACTGCTGGCAAACACACACAGTCTGTAGCAAGAATTGGGTGGCGAGC
GTCACCTACTTTGAAATCATTGGCATCATGGTTGGCCAGGCCGTTGTTGGCGTGCTTGGTGATTGGATTGGCCGT
CGCTGGGGTCTCATCCAGGACGCCCTCATCATGTTTATTGGCCTGCTCATGCTTACCGCTAGCTGGGGTCTTGAC
CAGCAGGGCTGGGTCATTTGCTACGCCTGCTCCCTCTTCTTTTACAGCGTTGGCGTTGGAGGCGAGTATCCCATT
ACCGCCACCAGCTCTCTAGAGAGCGCCGCCACGGCCGGCAAGCTCTCGACGCGCGAGGATCGCCTACACCGTGGC
CGCCGTGTCACAACGGCCTTTTTGATGCAGGGCTGGGGCCAATTTGTCAACCAAGTTGTCCTCATTGTCCTCCTC
GTCATCTTCAACAGCGGCAGGGGAGGCCCGCCCTACTCCACCTCTGCTGCCCAGTACACATATCGCCTGTCGTTT
GCCATTCCTGCCATTGGCACCGCATGGCTTGCATACTATAGGACGTGGAAGATGCCCTCGGCTTCCAAGAAGCTG
GCCGAGGCAAAGAGCCGCTCCAACGTGTCGGGCTACGACTTTAATGCCCTGCGCTACTGCTATGCGCACTTTGGT
GGCCGTTTGCTCGCCACGGCGGGCACCTGGTTTTGCAACGACGTCTTCTTTTATGGCAACAAGCTATTCCAGGGC
CAGTTCATCAAGGTGATTTCAAACAATCCCAAGTCTCTCATGACGTCGTGGACCTGGAGCCTTGTCAACATTGTC
GTTTCTCTTGCCGGCTACTATCTTGCCTCGTTTCTCATTGACAATAAGCTCTATGGCCGCAAAATGATGCAGCAG
CTCGGCTTCTTCATGTGCTTTCTCATGTTTGTCATTCCCGCCTTCAACTATGAATACTACACCAGCCCTGGCGGT
ATCCACGCATTCCAGGCCATGTACTTTCTCTCGTCCTTCTTCAACCAGTTTGGCCCCAACTCGGTCACCTTTCTT
GTCGCTGGCGAGGTTTTCCCCACGCCTGTCCGCGCCACGGCCCATGGCTTTTCGGCCTGTATTGGCAAATCAGGT
GCCCTGCTTGCCTCTGTGCTCTACAACTACATTGGCGACCAGACAAAGTTCTATGTGGTGCCGTGGTTTGGACTC
GCCGGCATGCTCCTCACCCTGGTCTTTCTCCCAGACACAACGGGACTGGACCTCAAGGAGCAGGAGCGCCGCTGG
AACTATATTTGCCAGGGCAAGGCGTCTGACTATCACGGCGTGGCAGTCAACCCAGCCCACTTGAGCTTGTGGGAG
CGCATGCGCGGAATTGGCAAGACTTATGACCCTGAGCTTGACTGGAAGGCAAAGATTGAAGACATGCGCGCCGAA
TGGGAAATGGTGCAGGCCAGCCGCGGGCCCAAGGAAACAGAGGACAATGCGGACCACGGCATGCCCGATGACGGC
GAGTTTTCTCCAGAGATTCACCAGTATTTTCAGCGCTCGAGTCCCAAGAAACTGCAGCCAAACGCCGTCATGAGC
GAAAAGGCAGTCTCTCATACATAG
Transcript >OphauB2|2411
ATGACGGCTGCACGCGATATCGACTCGTCGTCGTCGACGTCGTCGGAAATTCACCATGACCACCACCACCACCAC
CGCCACCACCACCACCATCAACGCCCAATCCCCGGCGAGGTGCCTGTGCCTCATGGTCCCTGCGGCGACCATGAC
AGCGACGACTTGGCCATGGCGGGCATCAGCCCCGATGAGCGTCGCATATTTGCCCATGTGACGCGTCCCGACGAC
TCGTACACACCAGACGGCGTCTACTGGGCCGATCTGCCTCTGTCGCGCCGCATCAAGTTTGTCTCGCAGCTCGAC
CGCAGCGCCGCGTCGCAAGAAGTGCACACAATTGGGCGCATGATGAAGCGCGATCCCCTATCGCCCGTTGGCTGG
TACTTTCGCCATGCCGTCATCCCCGGCGCTGGCCTCGGCCTGGAAGGCTATGTTCTCTTCTCAATTGGCAATCTC
GAGCCGCTCTTCAAGCAAGTATGGCCAGACTGCTGGCAAACACACACAGTCTGTAGCAAGAATTGGGTGGCGAGC
GTCACCTACTTTGAAATCATTGGCATCATGGTTGGCCAGGCCGTTGTTGGCGTGCTTGGTGATTGGATTGGCCGT
CGCTGGGGTCTCATCCAGGACGCCCTCATCATGTTTATTGGCCTGCTCATGCTTACCGCTAGCTGGGGTCTTGAC
CAGCAGGGCTGGGTCATTTGCTACGCCTGCTCCCTCTTCTTTTACAGCGTTGGCGTTGGAGGCGAGTATCCCATT
ACCGCCACCAGCTCTCTAGAGAGCGCCGCCACGGCCGGCAAGCTCTCGACGCGCGAGGATCGCCTACACCGTGGC
CGCCGTGTCACAACGGCCTTTTTGATGCAGGGCTGGGGCCAATTTGTCAACCAAGTTGTCCTCATTGTCCTCCTC
GTCATCTTCAACAGCGGCAGGGGAGGCCCGCCCTACTCCACCTCTGCTGCCCAGTACACATATCGCCTGTCGTTT
GCCATTCCTGCCATTGGCACCGCATGGCTTGCATACTATAGGACGTGGAAGATGCCCTCGGCTTCCAAGAAGCTG
GCCGAGGCAAAGAGCCGCTCCAACGTGTCGGGCTACGACTTTAATGCCCTGCGCTACTGCTATGCGCACTTTGGT
GGCCGTTTGCTCGCCACGGCGGGCACCTGGTTTTGCAACGACGTCTTCTTTTATGGCAACAAGCTATTCCAGGGC
CAGTTCATCAAGGTGATTTCAAACAATCCCAAGTCTCTCATGACGTCGTGGACCTGGAGCCTTGTCAACATTGTC
GTTTCTCTTGCCGGCTACTATCTTGCCTCGTTTCTCATTGACAATAAGCTCTATGGCCGCAAAATGATGCAGCAG
CTCGGCTTCTTCATGTGCTTTCTCATGTTTGTCATTCCCGCCTTCAACTATGAATACTACACCAGCCCTGGCGGT
ATCCACGCATTCCAGGCCATGTACTTTCTCTCGTCCTTCTTCAACCAGTTTGGCCCCAACTCGGTCACCTTTCTT
GTCGCTGGCGAGGTTTTCCCCACGCCTGTCCGCGCCACGGCCCATGGCTTTTCGGCCTGTATTGGCAAATCAGGT
GCCCTGCTTGCCTCTGTGCTCTACAACTACATTGGCGACCAGACAAAGTTCTATGTGGTGCCGTGGTTTGGACTC
GCCGGCATGCTCCTCACCCTGGTCTTTCTCCCAGACACAACGGGACTGGACCTCAAGGAGCAGGAGCGCCGCTGG
AACTATATTTGCCAGGGCAAGGCGTCTGACTATCACGGCGTGGCAGTCAACCCAGCCCACTTGAGCTTGTGGGAG
CGCATGCGCGGAATTGGCAAGACTTATGACCCTGAGCTTGACTGGAAGGCAAAGATTGAAGACATGCGCGCCGAA
TGGGAAATGGTGCAGGCCAGCCGCGGGCCCAAGGAAACAGAGGACAATGCGGACCACGGCATGCCCGATGACGGC
GAGTTTTCTCCAGAGATTCACCAGTATTTTCAGCGCTCGAGTCCCAAGAAACTGCAGCCAAACGCCGTCATGAGC
GAAAAGGCAGTCTCTCATACATAG
Gene >OphauB2|2411
ATGACGGCTGCACGCGATATCGACTCGTCGTCGTCGACGTCGTCGGAAATTCACCATGACCACCACCACCACCAC
CGCCACCACCACCACCATCAACGCCCAATCCCCGGCGAGGTGCCTGTGCCTCATGGTCCCTGCGGCGACCATGAC
AGCGACGACTTGGCCATGGCGGGCATCAGCCCCGATGAGCGTCGCATATTTGCCCATGTGACGCGTCCCGACGAC
TCGTACACACCAGACGGCGTCTACTGGGCCGATCTGCCTCTGTCGCGCCGCATCAAGTTTGTCTCGCAGCTCGAC
CGCAGCGCCGCGTCGCAAGAAGTGCACACAATTGGGCGCATGATGAAGCGCGATCCCCTATCGCCCGTTGGCTGG
TACTTTCGCCATGCCGTCATCCCCGGCGCTGGCCTCGGCCTGGAAGGCTATGTTCTCTTCTCAATTGGCAATCTC
GAGCCGCTCTTCAAGCAAGTATGGCCAGACTGCTGGCAAACACACACAGTCTGTAGCAAGAATTGGGTGGCGAGC
GTCACCTACTTTGAAATCATTGGCATCATGGTTGGCCAGGCCGTTGTTGGCGTACGTCTATTGTCTCCCTGACTA
AGCCCTGCTGCTGACGTGTTTTGGCCACGCAGGTGCTTGGTGATTGGATTGGCCGTCGCTGGGGTCTCATCCAGG
ACGCCCTCATCATGTTTATTGGCCTGCTCATGCTTACCGCTAGCTGGGGTCTTGACCAGCAGGGCTGGGTCATTT
GCTACGCCTGCTCCCTCTTCTTTTACAGTATGTCTTGGCGTGCCCCTTGTTTCCCCGCCTGGCCTAATTGTCACG
ACAGGCGTTGGCGTTGGAGGCGAGTATCCCATTACCGCCACCAGCTCTCTAGAGAGCGCCGCCACGGCCGGCAAG
CTCTCGACGCGCGAGGATCGCCTACACCGTGGCCGCCGTGTCACAACGGCCTTTTTGATGCAGGGCTGGGGCCAA
TTTGTCAACCAAGTTGTCCTCATTGTCCTCCTCGTCATCTTCAACAGCGGCAGGGGAGGCCCGCCCTACTCCACC
TCTGCTGCCCAGTACACATATCGCCTGTCGTTTGCCATTCCTGCCATTGGCACCGCATGGCTTGCATACTATAGG
ACGTGGAAGATGCCCTCGGCTTCCAAGAAGCTGGCCGAGGCAAAGAGCCGCTCCAACGTGTCGGGCTACGACTTT
AATGCCCTGCGCTACTGCTATGCGCACTTTGGTGGCCGTTTGCTCGCCACGGCGGGCACCTGGTTTTGCAACGAC
GTCTTCTTTTATGGCAACAAGCTATTCCAGGGCCAGTTCATCAAGGTGATTTCAAACAATCCCAAGTCTCTCATG
ACGTCGTGGACCTGGAGCCTTGTCAACATTGTCGTTTCTCTTGCCGGCTACTATCTTGCCTCGTTTCTCATTGAC
AATAAGCTCTATGGCCGCAAAATGATGCAGCAGCTCGGCTTCTTCATGTGCTTTCTCATGTTTGTCATTCCCGCC
TTCAACTATGAATACTACACCAGCCCTGGCGGTATCCACGCATTCCAGGCCATGTACTTTCTCTCGTCCTTCTTC
AACCAGTTTGGCCCCAACTCGGTCACCTTTCTTGTCGCTGGCGAGGTTTTCCCCACGCCTGTCCGCGCCACGGCC
CATGGCTTTTCGGCCTGTATTGGCAAATCAGGTGCCCTGCTTGCCTCTGTGCTCTACAACTACATTGGCGACCAG
ACAAAGTTCTATGTGGTGCCGTGGTTTGGACTCGCCGGCATGCTCCTCACCCTGGTCTTTCTCCCAGACACAACG
GGACTGGACCTCAAGGAGCAGGAGCGCCGCTGGAACTATATTTGCCAGGGCAAGGCGTCTGACTATCACGGCGTG
GCAGTCAACCCAGCCCACTTGAGCTTGTGGGAGCGCATGCGCGGAATTGGCAAGACTTATGACCCTGAGCTTGAC
TGGAAGGCAAAGATTGAAGACATGCGCGCCGAATGGGAAATGGTGCAGGCCAGCCGCGGGCCCAAGGAAACAGAG
GACAATGCGGACCACGGCATGCCCGATGACGGCGAGTTTTCTCCAGAGATTCACCAGTATTTTCAGCGCTCGAGT
CCCAAGAAACTGCAGCCAAACGCCGTCATGAGCGAAAAGGCAGTCTCTCATACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail