Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2410
Gene name
LocationContig_175:28858..34701
Strand+
Gene length (bp)5843
Transcript length (bp)5784
Coding sequence length (bp)5784
Protein length (aa) 1928

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.5E-37 727 874
PF00069 Pkinase Protein kinase domain 2.3E-19 1043 1140
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.4E-20 727 875
PF00072 Response_reg Response regulator receiver domain 4.9E-14 1525 1630

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38938|CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cek1 PE=1 SV=3 605 1294 4.0E-135
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 721 882 2.0E-65
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 690 878 1.0E-53
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 708 878 8.0E-53
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 723 923 3.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38938|CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cek1 PE=1 SV=3 605 1294 4.0E-135
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 721 882 2.0E-65
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 690 878 1.0E-53
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 708 878 8.0E-53
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 723 923 3.0E-52
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 709 878 9.0E-49
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 722 933 2.0E-47
sp|Q6NTJ3|GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis GN=mastl PE=1 SV=1 714 897 5.0E-47
sp|B1WAR9|GWL_XENTR Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis GN=mastl PE=2 SV=1 714 897 5.0E-47
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 1019 1353 1.0E-46
sp|E1C2I2|GWL_CHICK Serine/threonine-protein kinase greatwall OS=Gallus gallus GN=MASTL PE=3 SV=1 716 938 5.0E-46
sp|Q6DBX4|GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio GN=mastl PE=2 SV=1 721 897 1.0E-45
sp|Q8C0P0|GWL_MOUSE Serine/threonine-protein kinase greatwall OS=Mus musculus GN=Mastl PE=2 SV=2 714 957 2.0E-45
sp|D2HXI8|GWL_AILME Serine/threonine-protein kinase greatwall OS=Ailuropoda melanoleuca GN=MASTL PE=3 SV=1 714 988 3.0E-45
sp|E2RJI4|GWL_CANLF Serine/threonine-protein kinase greatwall OS=Canis lupus familiaris GN=MASTL PE=3 SV=1 714 897 9.0E-45
sp|Q96GX5|GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens GN=MASTL PE=1 SV=1 718 897 2.0E-44
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 715 877 9.0E-44
sp|E1BFR5|GWL_BOVIN Serine/threonine-protein kinase greatwall OS=Bos taurus GN=MASTL PE=3 SV=1 714 897 1.0E-43
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 694 877 2.0E-43
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 716 877 4.0E-43
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 694 877 2.0E-42
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 713 898 2.0E-42
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 720 877 2.0E-41
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 720 877 2.0E-41
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 721 877 4.0E-41
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 721 877 7.0E-41
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 721 877 7.0E-41
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 1044 1189 5.0E-38
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 666 877 6.0E-38
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 50 441 2.0E-37
sp|Q552E9|PKGA_DICDI Probable serine/threonine-protein kinase pkgA OS=Dictyostelium discoideum GN=pkgA PE=3 SV=1 1035 1198 2.0E-37
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 723 871 6.0E-37
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 722 872 8.0E-37
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 722 876 8.0E-37
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 723 871 1.0E-36
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 723 963 1.0E-36
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 723 871 2.0E-36
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 723 871 2.0E-36
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 723 871 2.0E-36
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 726 871 3.0E-36
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 722 872 4.0E-36
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 717 872 5.0E-36
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 726 871 6.0E-36
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 724 872 9.0E-36
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 724 913 1.0E-35
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 726 871 2.0E-35
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 725 872 3.0E-35
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 717 896 5.0E-35
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 723 871 6.0E-35
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 723 871 7.0E-35
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 724 872 7.0E-35
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 1050 1284 2.0E-34
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 726 871 2.0E-34
sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBK1 PE=3 SV=1 672 872 3.0E-34
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 726 871 3.0E-34
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 710 897 5.0E-34
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 1047 1284 2.0E-33
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 1050 1240 2.0E-33
sp|Q54HD2|NDRD_DICDI Probable serine/threonine-protein kinase ndrD OS=Dictyostelium discoideum GN=ndrD PE=3 SV=1 725 882 2.0E-33
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 725 871 2.0E-33
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 717 872 4.0E-33
sp|Q1ZXI5|Y1558_DICDI Probable serine/threonine-protein kinase DDB_G0278845 OS=Dictyostelium discoideum GN=DDB_G0278845 PE=3 SV=1 703 873 5.0E-33
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 722 871 8.0E-33
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 722 871 9.0E-33
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 726 871 1.0E-32
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 725 896 2.0E-32
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 724 870 3.0E-32
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 724 870 3.0E-32
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 723 879 3.0E-32
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 725 896 4.0E-32
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 725 896 5.0E-32
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 725 870 5.0E-32
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 717 896 7.0E-32
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 717 896 8.0E-32
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 717 896 1.0E-31
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 717 896 1.0E-31
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 724 878 1.0E-31
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 717 896 1.0E-31
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 724 870 2.0E-31
sp|P43565|RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM15 PE=1 SV=1 39 436 2.0E-31
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 724 896 2.0E-31
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 723 897 2.0E-31
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 724 917 3.0E-31
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 717 896 4.0E-31
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 717 896 4.0E-31
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 717 896 6.0E-31
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 717 896 6.0E-31
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 701 896 6.0E-31
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 702 896 6.0E-31
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 699 904 7.0E-31
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 724 872 7.0E-31
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 664 873 2.0E-30
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 676 873 2.0E-30
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 715 877 2.0E-30
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 699 904 3.0E-30
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 703 896 4.0E-30
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 642 870 5.0E-30
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 726 873 6.0E-30
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 725 870 7.0E-30
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 724 896 7.0E-30
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 719 905 9.0E-30
sp|Q559T8|Y0701_DICDI Probable serine/threonine-protein kinase DDB_G0272282 OS=Dictyostelium discoideum GN=DDB_G0272282 PE=3 SV=1 1047 1199 1.0E-29
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 724 896 1.0E-29
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 724 896 1.0E-29
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 723 899 1.0E-29
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 723 899 1.0E-29
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 726 871 1.0E-29
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 723 905 2.0E-29
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 726 898 2.0E-29
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 718 883 2.0E-29
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 707 873 3.0E-29
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 704 873 3.0E-29
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 723 899 3.0E-29
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 719 873 3.0E-29
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 726 873 3.0E-29
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 722 873 3.0E-29
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 712 904 3.0E-29
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 703 904 3.0E-29
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 726 873 4.0E-29
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 718 873 4.0E-29
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 724 876 5.0E-29
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 717 872 5.0E-29
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 700 902 6.0E-29
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 716 873 7.0E-29
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 716 873 7.0E-29
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 716 873 7.0E-29
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 688 873 7.0E-29
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 723 905 7.0E-29
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 718 883 9.0E-29
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 717 901 9.0E-29
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 723 899 1.0E-28
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 688 904 1.0E-28
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 718 873 1.0E-28
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 722 896 1.0E-28
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 717 870 1.0E-28
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 707 905 1.0E-28
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 708 896 1.0E-28
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 719 896 1.0E-28
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 719 873 2.0E-28
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 719 873 2.0E-28
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 718 873 2.0E-28
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 717 896 2.0E-28
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 724 909 2.0E-28
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 719 873 2.0E-28
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 707 905 2.0E-28
sp|O62846|KAPCG_MACMU cAMP-dependent protein kinase catalytic subunit gamma (Fragment) OS=Macaca mulatta GN=PRKACG PE=2 SV=3 718 873 2.0E-28
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 722 873 2.0E-28
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 723 905 3.0E-28
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 716 877 3.0E-28
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 684 896 3.0E-28
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 716 873 3.0E-28
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 726 873 3.0E-28
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 722 905 3.0E-28
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 716 873 3.0E-28
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 726 873 4.0E-28
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 725 873 4.0E-28
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 710 874 4.0E-28
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 710 874 4.0E-28
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 703 904 4.0E-28
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 707 905 4.0E-28
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 718 873 4.0E-28
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 707 905 4.0E-28
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 722 896 5.0E-28
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 703 904 5.0E-28
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 703 904 5.0E-28
sp|Q6DBX4|GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio GN=mastl PE=2 SV=1 1049 1190 6.0E-28
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 722 896 6.0E-28
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 708 873 7.0E-28
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 708 873 7.0E-28
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 708 873 7.0E-28
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 708 873 7.0E-28
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 722 896 7.0E-28
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 708 873 7.0E-28
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 719 904 1.0E-27
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 725 905 1.0E-27
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 706 896 1.0E-27
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 703 904 1.0E-27
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 722 885 2.0E-27
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 719 873 2.0E-27
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 726 873 2.0E-27
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 723 905 2.0E-27
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 719 873 2.0E-27
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 722 900 2.0E-27
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 718 873 2.0E-27
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 723 905 2.0E-27
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 686 901 2.0E-27
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 723 905 2.0E-27
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 723 905 2.0E-27
sp|E1BFR5|GWL_BOVIN Serine/threonine-protein kinase greatwall OS=Bos taurus GN=MASTL PE=3 SV=1 1048 1190 3.0E-27
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 1046 1189 3.0E-27
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 722 896 3.0E-27
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 718 873 3.0E-27
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 707 904 3.0E-27
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 723 905 3.0E-27
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 716 873 3.0E-27
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 1045 1210 4.0E-27
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 725 905 4.0E-27
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 722 904 4.0E-27
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 722 904 4.0E-27
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 723 896 4.0E-27
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 707 905 4.0E-27
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 718 873 4.0E-27
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 719 904 4.0E-27
sp|E1C2I2|GWL_CHICK Serine/threonine-protein kinase greatwall OS=Gallus gallus GN=MASTL PE=3 SV=1 1048 1190 5.0E-27
sp|E2RJI4|GWL_CANLF Serine/threonine-protein kinase greatwall OS=Canis lupus familiaris GN=MASTL PE=3 SV=1 1048 1190 5.0E-27
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 1046 1189 5.0E-27
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 1046 1189 5.0E-27
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 716 873 5.0E-27
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 716 873 5.0E-27
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 722 904 5.0E-27
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 722 885 6.0E-27
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 661 904 7.0E-27
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 707 896 7.0E-27
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 722 874 7.0E-27
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 718 873 8.0E-27
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 716 873 8.0E-27
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 714 904 8.0E-27
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 1046 1210 9.0E-27
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 714 901 9.0E-27
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 714 901 9.0E-27
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 707 904 9.0E-27
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 707 904 9.0E-27
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 722 873 9.0E-27
sp|Q8C0P0|GWL_MOUSE Serine/threonine-protein kinase greatwall OS=Mus musculus GN=Mastl PE=2 SV=2 1048 1190 1.0E-26
sp|Q96GX5|GWL_HUMAN Serine/threonine-protein kinase greatwall OS=Homo sapiens GN=MASTL PE=1 SV=1 1048 1191 1.0E-26
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 1046 1189 1.0E-26
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 702 873 1.0E-26
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 723 896 1.0E-26
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 707 904 1.0E-26
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 714 904 1.0E-26
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 717 872 1.0E-26
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 714 904 1.0E-26
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 714 904 1.0E-26
sp|P38938|CEK1_SCHPO Serine/threonine-protein kinase cek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cek1 PE=1 SV=3 51 533 2.0E-26
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 1046 1189 2.0E-26
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 718 909 2.0E-26
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 718 909 2.0E-26
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 722 904 2.0E-26
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 714 904 2.0E-26
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 718 909 2.0E-26
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 718 909 2.0E-26
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 714 904 2.0E-26
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 714 904 2.0E-26
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 718 909 2.0E-26
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 714 904 2.0E-26
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 717 896 2.0E-26
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 706 896 2.0E-26
sp|D2HXI8|GWL_AILME Serine/threonine-protein kinase greatwall OS=Ailuropoda melanoleuca GN=MASTL PE=3 SV=1 1048 1190 3.0E-26
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 714 904 3.0E-26
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 722 876 3.0E-26
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 725 905 4.0E-26
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 726 951 4.0E-26
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 715 896 4.0E-26
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 723 873 5.0E-26
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 720 874 5.0E-26
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 715 896 5.0E-26
sp|Q6NTJ3|GWL_XENLA Serine/threonine-protein kinase greatwall OS=Xenopus laevis GN=mastl PE=1 SV=1 1043 1190 6.0E-26
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 1046 1197 7.0E-26
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 1046 1189 7.0E-26
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 1046 1189 7.0E-26
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 726 872 7.0E-26
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 717 872 9.0E-26
sp|B1WAR9|GWL_XENTR Serine/threonine-protein kinase greatwall OS=Xenopus tropicalis GN=mastl PE=2 SV=1 1043 1190 1.0E-25
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 723 876 1.0E-25
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 722 904 1.0E-25
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 716 883 1.0E-25
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 723 876 1.0E-25
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 718 883 1.0E-25
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 723 876 1.0E-25
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 723 876 1.0E-25
sp|P21901|KAPL_APLCA Spermatozoon-associated protein kinase OS=Aplysia californica PE=2 SV=1 722 873 1.0E-25
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 726 872 1.0E-25
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 723 872 1.0E-25
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 723 872 2.0E-25
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 726 883 2.0E-25
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 723 876 3.0E-25
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 715 896 3.0E-25
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 725 876 3.0E-25
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 723 876 3.0E-25
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 702 904 3.0E-25
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 722 874 3.0E-25
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 725 896 4.0E-25
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 714 904 4.0E-25
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 723 876 4.0E-25
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 718 909 4.0E-25
sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp. indica GN=OsI_021818 PE=2 SV=1 723 872 4.0E-25
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 707 874 5.0E-25
sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp. japonica GN=Os06g0291600 PE=2 SV=1 723 872 5.0E-25
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 725 896 6.0E-25
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 714 904 6.0E-25
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 726 896 7.0E-25
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 722 903 8.0E-25
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 717 881 9.0E-25
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 726 896 1.0E-24
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 720 876 1.0E-24
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 726 873 2.0E-24
sp|P0C1B1|CBK1_EMENI Serine/threonine-protein kinase cbk1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbk1 PE=3 SV=2 717 875 2.0E-24
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 719 896 2.0E-24
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 719 896 2.0E-24
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 719 896 2.0E-24
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 724 874 3.0E-24
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 719 896 3.0E-24
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 726 873 4.0E-24
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 709 880 4.0E-24
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 724 874 4.0E-24
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 708 874 5.0E-24
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 716 873 5.0E-24
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 723 874 6.0E-24
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 722 896 7.0E-24
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 722 896 1.0E-23
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 725 876 1.0E-23
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 725 870 1.0E-23
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 708 874 1.0E-23
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 1045 1220 2.0E-23
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 723 873 2.0E-23
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 725 924 2.0E-23
sp|Q1PFB9|AGC17_ARATH Serine/threonine-protein kinase AGC1-7 OS=Arabidopsis thaliana GN=AGC1-7 PE=1 SV=1 719 872 2.0E-23
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 726 874 2.0E-23
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 726 896 2.0E-23
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 723 897 2.0E-23
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 1041 1187 3.0E-23
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 722 905 3.0E-23
sp|Q05999|D6KL3_ARATH Serine/threonine-protein kinase D6PKL3 OS=Arabidopsis thaliana GN=D6PKL3 PE=1 SV=1 724 872 3.0E-23
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 720 980 4.0E-23
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 723 874 4.0E-23
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 717 873 5.0E-23
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 722 952 5.0E-23
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 1045 1220 6.0E-23
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 722 904 6.0E-23
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 1041 1187 7.0E-23
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 698 896 7.0E-23
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 1041 1187 8.0E-23
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 708 898 8.0E-23
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 1045 1220 1.0E-22
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 722 873 1.0E-22
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 726 905 1.0E-22
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 726 893 1.0E-22
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 725 870 1.0E-22
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 1020 1187 2.0E-22
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 1045 1229 2.0E-22
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 1045 1187 2.0E-22
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 1045 1187 2.0E-22
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 1044 1215 2.0E-22
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 1044 1215 2.0E-22
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 716 873 2.0E-22
sp|Q39183|D6KL2_ARATH Serine/threonine-protein kinase D6PKL2 OS=Arabidopsis thaliana GN=D6PKL2 PE=1 SV=1 723 877 2.0E-22
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 723 873 2.0E-22
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 725 870 2.0E-22
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 726 893 2.0E-22
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 708 872 2.0E-22
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 726 872 3.0E-22
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 702 872 3.0E-22
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 732 904 3.0E-22
sp|Q9LFA2|KIPK_ARATH Serine/threonine-protein kinase KIPK OS=Arabidopsis thaliana GN=KIPK PE=1 SV=1 723 872 3.0E-22
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 1045 1187 4.0E-22
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 722 904 4.0E-22
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 723 873 4.0E-22
sp|F4I4F2|RHS3_ARATH Serine/threonine-protein kinase RHS3 OS=Arabidopsis thaliana GN=RHS3 PE=1 SV=1 717 872 4.0E-22
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 726 880 4.0E-22
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 1050 1196 5.0E-22
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 1045 1187 5.0E-22
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 1045 1187 5.0E-22
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 723 886 5.0E-22
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 726 874 5.0E-22
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 719 873 5.0E-22
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 700 874 5.0E-22
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 1050 1195 6.0E-22
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 726 874 6.0E-22
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 722 921 7.0E-22
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 725 870 8.0E-22
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 723 873 8.0E-22
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 1041 1187 9.0E-22
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 726 874 9.0E-22
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 699 896 9.0E-22
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 723 873 9.0E-22
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 723 872 9.0E-22
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 1050 1196 1.0E-21
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 1049 1188 1.0E-21
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 1044 1215 1.0E-21
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 1041 1187 1.0E-21
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 722 921 1.0E-21
sp|Q9LTW5|AGC15_ARATH Serine/threonine-protein kinase AGC1-5 OS=Arabidopsis thaliana GN=AGC1-5 PE=1 SV=1 720 872 1.0E-21
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 726 894 1.0E-21
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 722 921 1.0E-21
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 722 872 1.0E-21
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 1049 1236 2.0E-21
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 1044 1215 2.0E-21
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 1045 1187 2.0E-21
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 1045 1187 2.0E-21
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 720 872 2.0E-21
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 723 874 2.0E-21
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 710 872 2.0E-21
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 722 921 2.0E-21
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 723 874 2.0E-21
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 722 921 2.0E-21
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 719 878 2.0E-21
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 723 872 2.0E-21
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 622 905 2.0E-21
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 723 886 2.0E-21
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 712 872 2.0E-21
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 722 872 2.0E-21
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 1045 1220 3.0E-21
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 1045 1187 3.0E-21
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 1045 1187 3.0E-21
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 1045 1220 3.0E-21
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 1049 1226 3.0E-21
sp|P15792|KPK1_PHAVU Protein kinase PVPK-1 OS=Phaseolus vulgaris PE=2 SV=1 723 872 3.0E-21
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 722 876 3.0E-21
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 1045 1187 4.0E-21
sp|Q9LFA2|KIPK_ARATH Serine/threonine-protein kinase KIPK OS=Arabidopsis thaliana GN=KIPK PE=1 SV=1 1022 1166 4.0E-21
sp|Q9FG74|D6PK_ARATH Serine/threonine-protein kinase D6PK OS=Arabidopsis thaliana GN=D6PK PE=1 SV=1 723 898 4.0E-21
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 722 906 4.0E-21
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 705 872 4.0E-21
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 722 921 4.0E-21
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 1045 1220 5.0E-21
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 723 874 5.0E-21
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 723 880 5.0E-21
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 726 872 5.0E-21
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 723 874 5.0E-21
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 726 874 5.0E-21
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 723 880 5.0E-21
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 722 921 5.0E-21
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 1043 1187 6.0E-21
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 1045 1187 6.0E-21
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 726 898 6.0E-21
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 713 874 7.0E-21
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 1022 1187 8.0E-21
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 722 921 8.0E-21
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 726 896 9.0E-21
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 1045 1187 1.0E-20
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 1045 1187 1.0E-20
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 1041 1187 1.0E-20
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 1049 1179 1.0E-20
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 719 901 1.0E-20
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 726 880 1.0E-20
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 726 886 1.0E-20
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 723 905 1.0E-20
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 719 905 1.0E-20
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 732 873 1.0E-20
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 704 872 1.0E-20
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 722 870 1.0E-20
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 726 874 1.0E-20
sp|P53894|CBK1_YEAST Serine/threonine-protein kinase CBK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBK1 PE=1 SV=1 1050 1186 2.0E-20
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 1045 1187 2.0E-20
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 1044 1188 2.0E-20
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 1041 1187 2.0E-20
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 1036 1180 2.0E-20
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 703 872 2.0E-20
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 717 883 2.0E-20
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 723 873 2.0E-20
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 723 874 2.0E-20
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 940 1163 2.0E-20
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 723 909 2.0E-20
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 726 872 2.0E-20
sp|Q54HD2|NDRD_DICDI Probable serine/threonine-protein kinase ndrD OS=Dictyostelium discoideum GN=ndrD PE=3 SV=1 1050 1274 3.0E-20
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 1050 1206 3.0E-20
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 1049 1186 3.0E-20
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 1043 1187 3.0E-20
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 720 897 3.0E-20
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 732 909 3.0E-20
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 723 874 3.0E-20
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 717 903 3.0E-20
sp|Q1ZXI5|Y1558_DICDI Probable serine/threonine-protein kinase DDB_G0278845 OS=Dictyostelium discoideum GN=DDB_G0278845 PE=3 SV=1 1050 1196 4.0E-20
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 708 903 4.0E-20
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 723 909 4.0E-20
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 723 873 4.0E-20
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 1045 1187 5.0E-20
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 1041 1187 5.0E-20
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 722 872 5.0E-20
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 723 874 5.0E-20
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 715 872 5.0E-20
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 717 896 5.0E-20
sp|Q39183|D6KL2_ARATH Serine/threonine-protein kinase D6PKL2 OS=Arabidopsis thaliana GN=D6PKL2 PE=1 SV=1 1034 1163 6.0E-20
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 1029 1163 6.0E-20
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 703 872 6.0E-20
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 703 872 6.0E-20
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 622 876 6.0E-20
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 708 874 6.0E-20
sp|Q9SUA3|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1 OS=Arabidopsis thaliana GN=D6PKL1 PE=1 SV=1 723 872 6.0E-20
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 723 873 6.0E-20
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 1036 1180 7.0E-20
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 706 880 7.0E-20
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 726 874 7.0E-20
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 1050 1303 8.0E-20
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 1036 1180 8.0E-20
sp|Q2QM77|PID_ORYSJ Protein kinase PINOID OS=Oryza sativa subsp. japonica GN=PID PE=2 SV=1 724 872 8.0E-20
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 723 873 8.0E-20
sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBK1 PE=3 SV=1 1046 1186 9.0E-20
sp|Q6FP74|CBK1_CANGA Serine/threonine-protein kinase CBK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CBK1 PE=3 SV=1 1050 1186 1.0E-19
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 1050 1303 1.0E-19
sp|A2YBX5|G11A_ORYSI Protein kinase G11A OS=Oryza sativa subsp. indica GN=OsI_021818 PE=2 SV=1 1034 1166 1.0E-19
sp|Q0DCT8|G11A_ORYSJ Protein kinase G11A OS=Oryza sativa subsp. japonica GN=Os06g0291600 PE=2 SV=1 1034 1166 1.0E-19
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 719 901 1.0E-19
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 726 874 1.0E-19
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 707 873 1.0E-19
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 701 873 1.0E-19
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 720 872 1.0E-19
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 723 886 1.0E-19
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 682 872 1.0E-19
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 724 872 1.0E-19
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 1049 1187 2.0E-19
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 1050 1188 2.0E-19
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 1050 1215 2.0E-19
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 1051 1187 2.0E-19
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 1051 1187 2.0E-19
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 1051 1187 2.0E-19
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 1051 1187 2.0E-19
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 1051 1187 2.0E-19
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 1051 1187 2.0E-19
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 1051 1187 2.0E-19
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 1051 1187 2.0E-19
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 1044 1187 2.0E-19
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 1049 1177 2.0E-19
sp|Q05999|D6KL3_ARATH Serine/threonine-protein kinase D6PKL3 OS=Arabidopsis thaliana GN=D6PKL3 PE=1 SV=1 1049 1182 2.0E-19
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 1044 1187 2.0E-19
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 685 894 2.0E-19
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 672 876 2.0E-19
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 732 891 2.0E-19
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 726 879 2.0E-19
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 720 921 2.0E-19
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 720 921 2.0E-19
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 720 878 2.0E-19
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 722 897 2.0E-19
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 719 899 2.0E-19
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 720 897 2.0E-19
sp|Q8BWW9|PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus GN=Pkn2 PE=1 SV=3 720 905 2.0E-19
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 1046 1187 3.0E-19
sp|P31034|CBK1_KLULA Serine/threonine-protein kinase CBK1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBK1 PE=3 SV=2 1050 1186 3.0E-19
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 1049 1187 3.0E-19
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 1049 1187 3.0E-19
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 1051 1187 3.0E-19
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 1043 1199 3.0E-19
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 1043 1187 3.0E-19
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 714 887 3.0E-19
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 722 872 3.0E-19
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 720 878 3.0E-19
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 722 872 3.0E-19
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 720 897 3.0E-19
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 722 872 3.0E-19
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 1044 1188 3.0E-19
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 1050 1186 4.0E-19
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 1038 1187 4.0E-19
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 1051 1187 4.0E-19
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 723 886 4.0E-19
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 723 886 4.0E-19
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 723 874 4.0E-19
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 720 872 4.0E-19
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 1045 1189 5.0E-19
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 720 897 5.0E-19
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 719 872 5.0E-19
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 720 897 5.0E-19
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 720 897 5.0E-19
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 689 872 5.0E-19
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 723 872 5.0E-19
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 1044 1187 5.0E-19
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 724 899 5.0E-19
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 1040 1187 6.0E-19
sp|Q9LTW5|AGC15_ARATH Serine/threonine-protein kinase AGC1-5 OS=Arabidopsis thaliana GN=AGC1-5 PE=1 SV=1 1033 1211 6.0E-19
sp|A1Z7T0|PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster GN=Pkn PE=1 SV=1 1044 1187 6.0E-19
sp|P43565|RIM15_YEAST Serine/threonine-protein kinase RIM15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM15 PE=1 SV=1 1430 1635 7.0E-19
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 702 872 7.0E-19
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 709 874 7.0E-19
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 671 870 7.0E-19
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 720 897 8.0E-19
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 732 917 8.0E-19
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 663 896 8.0E-19
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 1044 1188 9.0E-19
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 1040 1187 1.0E-18
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 1050 1188 1.0E-18
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 1045 1187 1.0E-18
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 1044 1187 1.0E-18
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 1051 1207 1.0E-18
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 726 909 1.0E-18
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 720 894 1.0E-18
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 725 870 1.0E-18
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 701 902 1.0E-18
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 726 878 1.0E-18
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 710 872 1.0E-18
sp|O08874|PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus GN=Pkn2 PE=1 SV=2 1044 1187 1.0E-18
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 1045 1183 2.0E-18
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 1043 1187 2.0E-18
sp|F4I4F2|RHS3_ARATH Serine/threonine-protein kinase RHS3 OS=Arabidopsis thaliana GN=RHS3 PE=1 SV=1 1049 1217 2.0E-18
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 624 905 2.0E-18
sp|Q9Z335|SBK1_RAT Serine/threonine-protein kinase SBK1 OS=Rattus norvegicus GN=Sbk1 PE=1 SV=1 724 899 2.0E-18
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 720 894 2.0E-18
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 724 899 2.0E-18
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 726 898 2.0E-18
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 726 872 2.0E-18
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 1049 1166 3.0E-18
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 1051 1187 3.0E-18
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 1051 1187 3.0E-18
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 1051 1187 3.0E-18
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 1049 1187 3.0E-18
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 1051 1187 3.0E-18
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 1051 1187 3.0E-18
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 1051 1187 3.0E-18
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 1044 1187 3.0E-18
sp|P15792|KPK1_PHAVU Protein kinase PVPK-1 OS=Phaseolus vulgaris PE=2 SV=1 1029 1163 3.0E-18
sp|Q8BWW9|PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus GN=Pkn2 PE=1 SV=3 1044 1187 3.0E-18
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 723 872 3.0E-18
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 726 872 3.0E-18
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 689 873 3.0E-18
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 686 874 3.0E-18
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 723 872 3.0E-18
sp|Q64FQ2|PID2_ARATH Protein kinase PINOID 2 OS=Arabidopsis thaliana GN=PID2 PE=1 SV=1 723 872 3.0E-18
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 720 894 3.0E-18
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 732 917 3.0E-18
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 719 901 3.0E-18
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 720 894 3.0E-18
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 663 897 3.0E-18
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 1046 1186 4.0E-18
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 1045 1190 4.0E-18
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 1049 1187 4.0E-18
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 1049 1187 4.0E-18
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 1045 1187 4.0E-18
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 719 901 4.0E-18
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 720 874 4.0E-18
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 714 874 4.0E-18
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 723 871 4.0E-18
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 1045 1190 5.0E-18
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 1045 1190 5.0E-18
sp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG1 OS=Arabidopsis thaliana GN=WAG1 PE=2 SV=1 1050 1163 5.0E-18
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 719 897 5.0E-18
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 724 909 5.0E-18
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 699 874 5.0E-18
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 1045 1190 6.0E-18
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 1045 1190 6.0E-18
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 1049 1179 6.0E-18
sp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG2 OS=Arabidopsis thaliana GN=WAG2 PE=2 SV=1 1046 1163 6.0E-18
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 715 874 6.0E-18
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 724 909 6.0E-18
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 722 886 6.0E-18
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 721 879 6.0E-18
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 717 905 6.0E-18
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 726 898 6.0E-18
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 715 874 7.0E-18
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 723 874 7.0E-18
sp|Q9LT38|UNCL_ARATH Serine/threonine-protein kinase UCNL OS=Arabidopsis thaliana GN=UCNL PE=2 SV=1 1049 1183 7.0E-18
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 723 874 7.0E-18
sp|Q754N7|CBK1_ASHGO Serine/threonine-protein kinase CBK1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBK1 PE=3 SV=1 1050 1186 8.0E-18
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 1044 1187 8.0E-18
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 1049 1187 8.0E-18
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 1049 1187 8.0E-18
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 1051 1187 8.0E-18
sp|Q9FG74|D6PK_ARATH Serine/threonine-protein kinase D6PK OS=Arabidopsis thaliana GN=D6PK PE=1 SV=1 1049 1163 8.0E-18
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 726 907 8.0E-18
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 699 872 8.0E-18
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 1050 1218 9.0E-18
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 1047 1186 9.0E-18
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 1049 1187 9.0E-18
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 1049 1187 9.0E-18
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 723 874 9.0E-18
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 722 872 9.0E-18
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 723 872 9.0E-18
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 1045 1182 1.0E-17
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 1044 1187 1.0E-17
sp|Q1PFB9|AGC17_ARATH Serine/threonine-protein kinase AGC1-7 OS=Arabidopsis thaliana GN=AGC1-7 PE=1 SV=1 1049 1176 1.0E-17
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 719 901 1.0E-17
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 723 873 1.0E-17
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 704 874 1.0E-17
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 724 909 1.0E-17
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 724 905 1.0E-17
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 730 898 1.0E-17
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 726 896 1.0E-17
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1049 1187 2.0E-17
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 1049 1187 2.0E-17
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 1044 1187 2.0E-17
sp|Q2QM77|PID_ORYSJ Protein kinase PINOID OS=Oryza sativa subsp. japonica GN=PID PE=2 SV=1 1034 1175 2.0E-17
sp|Q64FQ2|PID2_ARATH Protein kinase PINOID 2 OS=Arabidopsis thaliana GN=PID2 PE=1 SV=1 1047 1184 2.0E-17
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 1044 1187 3.0E-17
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1049 1187 3.0E-17
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 1049 1197 3.0E-17
sp|Q9SUA3|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1 OS=Arabidopsis thaliana GN=D6PKL1 PE=1 SV=1 1049 1163 3.0E-17
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 1049 1166 3.0E-17
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 1036 1166 3.0E-17
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 1044 1187 4.0E-17
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 1044 1187 4.0E-17
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 1045 1187 5.0E-17
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 1045 1187 5.0E-17
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 1045 1187 5.0E-17
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 1045 1187 5.0E-17
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 1045 1187 5.0E-17
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 1043 1187 6.0E-17
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 1050 1218 7.0E-17
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 1050 1188 7.0E-17
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 1049 1187 7.0E-17
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 1049 1236 7.0E-17
sp|P0C1B1|CBK1_EMENI Serine/threonine-protein kinase cbk1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbk1 PE=3 SV=2 1026 1219 7.0E-17
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 1045 1179 7.0E-17
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 1044 1187 7.0E-17
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 1050 1217 8.0E-17
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 1049 1188 8.0E-17
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 1049 1189 8.0E-17
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 1049 1219 8.0E-17
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 1042 1176 8.0E-17
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 1042 1176 8.0E-17
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 1049 1189 9.0E-17
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 1049 1189 9.0E-17
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 1049 1189 9.0E-17
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 1049 1189 9.0E-17
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 1049 1187 9.0E-17
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 1042 1166 9.0E-17
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 1050 1187 1.0E-16
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 1050 1187 1.0E-16
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 1050 1186 1.0E-16
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 1050 1187 1.0E-16
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 1050 1188 1.0E-16
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 1012 1186 1.0E-16
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1049 1187 1.0E-16
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 1042 1166 1.0E-16
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 1042 1166 1.0E-16
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 1044 1187 1.0E-16
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 1049 1187 2.0E-16
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 1049 1187 2.0E-16
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 1049 1187 2.0E-16
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 1050 1187 2.0E-16
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 1049 1187 2.0E-16
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 1045 1187 2.0E-16
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 1042 1166 2.0E-16
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 1042 1189 2.0E-16
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 1049 1189 2.0E-16
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 1017 1203 3.0E-16
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 1045 1187 3.0E-16
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 1045 1188 3.0E-16
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 1045 1187 4.0E-16
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 1050 1187 4.0E-16
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 1049 1188 4.0E-16
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 1044 1187 4.0E-16
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 1042 1167 4.0E-16
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 1047 1189 5.0E-16
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 1049 1204 5.0E-16
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 1042 1189 5.0E-16
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 1042 1189 5.0E-16
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 1049 1188 5.0E-16
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 1049 1188 5.0E-16
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 1049 1188 5.0E-16
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 1041 1187 8.0E-16
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 1045 1187 8.0E-16
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 1049 1187 9.0E-16
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 1045 1187 9.0E-16
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 1042 1179 9.0E-16
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 1045 1187 9.0E-16
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 1045 1172 1.0E-15
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 1045 1187 1.0E-15
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 1049 1187 1.0E-15
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 1049 1186 1.0E-15
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 1045 1187 1.0E-15
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 1054 1215 1.0E-15
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 1045 1188 1.0E-15
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 1050 1187 2.0E-15
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 1049 1188 2.0E-15
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 1049 1187 2.0E-15
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 1050 1187 2.0E-15
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 1049 1189 2.0E-15
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 1050 1218 3.0E-15
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 1049 1187 3.0E-15
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 1049 1166 3.0E-15
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 1049 1166 3.0E-15
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 1044 1171 3.0E-15
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 1041 1187 3.0E-15
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 1050 1187 4.0E-15
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 1044 1213 4.0E-15
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 1045 1172 4.0E-15
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 1051 1186 4.0E-15
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 1050 1187 4.0E-15
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 1049 1166 4.0E-15
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 1049 1166 4.0E-15
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 1049 1166 5.0E-15
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 1044 1211 5.0E-15
sp|Q9LT38|UNCL_ARATH Serine/threonine-protein kinase UCNL OS=Arabidopsis thaliana GN=UCNL PE=2 SV=1 729 906 5.0E-15
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 1051 1187 6.0E-15
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 1045 1187 6.0E-15
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 1049 1166 7.0E-15
sp|O08874|PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus GN=Pkn2 PE=1 SV=2 596 905 8.0E-15
sp|Q9LUL2|WAG2_ARATH Serine/threonine-protein kinase WAG2 OS=Arabidopsis thaliana GN=WAG2 PE=2 SV=1 723 871 8.0E-15
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 1042 1175 1.0E-14
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 1042 1175 1.0E-14
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 1042 1175 1.0E-14
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 1042 1175 1.0E-14
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 1044 1226 1.0E-14
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 1043 1157 1.0E-14
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 1050 1187 2.0E-14
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 1042 1186 2.0E-14
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 1049 1187 2.0E-14
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 1050 1187 3.0E-14
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 1041 1187 3.0E-14
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 1049 1211 3.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 1041 1187 3.0E-14
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 1049 1187 3.0E-14
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 1045 1187 3.0E-14
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 1049 1187 3.0E-14
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 1050 1187 4.0E-14
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 1050 1187 4.0E-14
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 1050 1187 5.0E-14
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 1050 1187 5.0E-14
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 1049 1211 5.0E-14
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 1049 1187 5.0E-14
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 1049 1187 5.0E-14
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 1049 1212 6.0E-14
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 1045 1188 6.0E-14
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 1049 1164 6.0E-14
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 1049 1187 9.0E-14
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 1050 1187 1.0E-13
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 1050 1187 1.0E-13
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 1049 1166 1.0E-13
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 1050 1166 1.0E-13
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 1042 1161 2.0E-13
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 1049 1187 2.0E-13
sp|Q9C8M5|WAG1_ARATH Serine/threonine-protein kinase WAG1 OS=Arabidopsis thaliana GN=WAG1 PE=2 SV=1 723 871 2.0E-13
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 1050 1227 3.0E-13
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 1045 1187 3.0E-13
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 1045 1187 3.0E-13
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 1042 1189 3.0E-13
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 1049 1187 4.0E-13
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 1050 1164 4.0E-13
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 1038 1137 4.0E-13
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 1051 1180 7.0E-13
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 1045 1187 8.0E-13
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 1051 1181 1.0E-12
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 1050 1187 1.0E-12
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 1049 1166 1.0E-12
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 1050 1187 2.0E-12
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 1050 1187 2.0E-12
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 1050 1187 2.0E-12
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 730 874 2.0E-12
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 1050 1164 2.0E-12
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 1050 1187 3.0E-12
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 730 873 3.0E-12
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 732 874 4.0E-12
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 1049 1136 4.0E-12
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 1050 1164 5.0E-12
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 1050 1187 6.0E-12
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 1042 1157 6.0E-12
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 1040 1164 7.0E-12
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 1049 1162 7.0E-12
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 1042 1137 7.0E-12
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 1038 1159 9.0E-12
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 1050 1187 1.0E-11
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 720 928 1.0E-11
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 1042 1137 1.0E-11
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 1050 1166 2.0E-11
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 1049 1136 2.0E-11
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 1042 1137 2.0E-11
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 1049 1187 3.0E-11
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 1050 1187 3.0E-11
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 1039 1188 3.0E-11
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 1050 1164 3.0E-11
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 1049 1136 3.0E-11
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 1046 1166 4.0E-11
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 1049 1162 5.0E-11
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 1042 1137 6.0E-11
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 1038 1159 6.0E-11
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 1044 1166 6.0E-11
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 1044 1166 7.0E-11
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 1050 1187 8.0E-11
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 1043 1166 1.0E-10
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 730 874 2.0E-10
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 1045 1137 2.0E-10
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 1044 1166 2.0E-10
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 1043 1157 3.0E-10
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 1044 1166 3.0E-10
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 1051 1166 4.0E-10
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 1041 1217 4.0E-10
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 1039 1166 4.0E-10
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 1049 1164 9.0E-10
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 1051 1157 2.0E-09
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 1050 1167 4.0E-09
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 1050 1166 4.0E-09
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 1042 1175 4.0E-09
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 718 870 6.0E-09
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 1050 1167 6.0E-09
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 1050 1167 6.0E-09
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 1050 1167 6.0E-09
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 1050 1167 7.0E-09
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 1051 1160 7.0E-09
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 1040 1161 8.0E-09
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 1050 1167 9.0E-09
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 1046 1148 9.0E-09
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 1045 1158 2.0E-08
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 1040 1164 5.0E-08
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 1040 1160 5.0E-08
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 1044 1109 6.0E-08
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 37 235 1.0E-07
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 1050 1160 1.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 726 873 2.0E-07
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 726 873 3.0E-07
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 1052 1159 3.0E-07
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 1050 1160 3.0E-07
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 1050 1160 3.0E-07
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 726 873 4.0E-07
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1052 1141 4.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 1052 1139 5.0E-07
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 1052 1139 6.0E-07
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 801 874 7.0E-07
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 726 873 7.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 726 873 7.0E-07
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 1035 1166 7.0E-07
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1052 1141 8.0E-07
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1052 1141 9.0E-07
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 1052 1141 1.0E-06
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 700 873 1.0E-06
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 1437 1639 5.0E-06
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 726 928 5.0E-06
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 726 873 6.0E-06
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 725 873 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006468 protein phosphorylation Yes
GO:0005524 ATP binding Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0004672 protein kinase activity Yes
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0035556 intracellular signal transduction No
GO:0007165 signal transduction No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0065007 biological regulation No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0071704 organic substance metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2410
MDRPVASLAPPAVASLRAQHGGMMERSLSQDIREEREELREAAEQTLNAIVDLNLDGTIRWVSPSWTDVIGTPFE
AVNGIPITDLIVSDNKTVFSDVVDSMKRDDSKSYRVSFVIQLGPLSKLQSMDAIASTEAQTSQLEAQGIMVYDSA
SGGESHTMWMLRPWSGPHEIKIDLPQVIVDSLGSGAEILASYLTQLADSAGDESCSREPPPWVLCRICERQIQPW
WFEKHTDLCLQEHRAEMDVQMAQENLTEHRHAIVRVLDDLEARKSRSMIGEQPAGPVAEYKGISIGPPPSTQSSP
GSSLARSRDRTTGLGHSRARSFAVRRPQARIVELLMDLCDTAIEISSPAIKESSALQEDGEIRTQSPQSESRICQ
VMQWQSPSTNTLDQEQGLALLCSDTERVAKAKVDAVFRHRKILEYAERIRVELAVLVEACVDSAMKKAARVAAGR
LSDSSDSEGESSQGERELETQPGAGLQPEEADDVVADPTRAGEECRGRSAEGQARPGQTTDGSSALATALRQMDL
SAASSRSRSRPTSFVASTRSSSPRECATPRSHADGGLMRDLRRGSSLSHETEIADSEGSLRSSSVTSRHAAPRME
SPIPELGDLRRAASARQHHRQSLIIPGTSSPHRQESPSRAAQPSSPLRIKPRILPVSHEGVVSPEASPMFPSSEF
SSPISHPVRHHRRQSSAAISDLAMRAPPSPRLSASQAPPQPRPAQPSIKDFEIIKPISKGAFGSVYLSKKKSTGE
YFAIKVLKKADMVAKNQVGNVKAERAIMMWQGQSDFVAKLYWTFSSKDYLYLVMEYLNGGDCASLIKVLGGLPED
WVKKYLGEVILGVEHLHERDIIHRDLKPDNLLIDQKGHLKLTDFGLSRMGLVGRQKRALNSETAETTPDLLKQGP
FARSTSMASSRSTSLDLQGHSNSPGATPQVTPESGSVSQPGLFSLGSLQQEPRRVSSSHCSDSGGSEVLSNMLTS
LSIHESDAAGQSANSSAKIACEDDAVAQSSPDLTAHQGGFRISVDNHTRNSLPQSSMMPPPMALFDPQDTNRRFV
GTPDYLAPETIKGDKQDETSDWWSVGCIMFEFLYGIPPFHAGEAEQVFDNILARNIQWPDASTCEAVSDEAKDVI
NKLLCMDPKQRLGANRDDKFASGGEEIRSHAWFQGISWQTLLEDEAQFVPQLENPEDTEYFDARGAVLQSFAEEM
EDQMSPQSSTAGSDYPDRPHDALSRVRSQVNSMSRKLMPLHIPPHVRDLKSRRLSEPVATDDFGSFTFKNLPVLE
KANKDVIQKLRADALATQSKLSAASPGPSASAASPAPSLDASPIFSGHLHRTISNAKAGNRPQSPSGLSHSNSSP
SRASQPSSPLMVSFVAGQGGEGRRKASSNSSSLSHQSSSVQASATVDVPKVPPSLQKAATSVAAMSPIKGRGTTP
APLPLSPQKMIATPRQGSTSSTSRSRSLTVGSQEASPITSDMIHPHRNRRSQVFDMSPSSSDNEGDKHNALLRVQ
RRRQSSRRLSQIAFDGGPTFRPLDVLICEDHPVSRMVMEKLLEKLRCRTISVANGSEAVRYSLSEIQFDAIFLEF
KLPQINGADVARMIRETKNANSHTPIVAITAYLKELQAPHYFDSLVEKPISSSKLSEVLSSLCQWRPDSPQRAAS
GPLPHPIHIGLKKTASRTDDSPPSSLSAFAGRFGSAVVSSRDESMSSSLFGDAELVTSDDMALTLSRKTTGDWDV
TDATQELVCAGPSSRGMPVLVAQQSAPGQIEHLARIQNKREGVGRRTIECTESADDEDDEADAAIRDSHVRRSSK
ATAGKAVFPSSKLAIEMMRADSHDSVVVSSDNTSEVATQVATTPSLAMATPMLWAVGEDDAKRAPPEEDTSEAHG
GPGPVAAAADDEEERKARCEGMDATPRPSALARLQETCEAGDDEATPRACGK*
Coding >OphauB2|2410
ATGGACCGCCCCGTGGCCTCGCTGGCGCCACCGGCCGTGGCTTCGCTCAGGGCCCAACATGGCGGCATGATGGAA
AGGTCTTTGAGTCAGGACATACGAGAGGAGCGAGAAGAGCTCCGTGAGGCCGCAGAGCAGACACTCAACGCAATT
GTCGACCTTAACCTCGATGGCACCATCAGATGGGTTAGTCCGTCATGGACCGATGTCATTGGCACACCTTTCGAA
GCGGTCAACGGCATTCCAATCACTGATCTGATTGTCAGCGACAACAAGACTGTTTTCTCAGATGTTGTCGACTCA
ATGAAGCGCGATGACTCCAAGAGCTACCGTGTTAGTTTTGTCATTCAATTGGGCCCACTCTCCAAGCTACAGTCC
ATGGACGCCATTGCCTCGACTGAAGCCCAGACCAGTCAGCTTGAAGCCCAAGGCATCATGGTGTACGACAGTGCC
TCTGGTGGAGAGAGTCATACCATGTGGATGCTTCGTCCGTGGTCTGGGCCGCACGAGATCAAAATTGATCTGCCC
CAAGTCATTGTAGATTCGCTTGGCTCAGGCGCCGAGATTCTTGCCAGCTATCTCACACAGCTGGCTGATTCGGCA
GGCGACGAGTCTTGTTCGCGCGAGCCCCCTCCCTGGGTCCTCTGCCGCATTTGTGAGCGCCAGATACAACCCTGG
TGGTTTGAAAAACACACCGATTTATGCCTACAGGAACATCGTGCCGAGATGGATGTTCAAATGGCGCAAGAGAAC
CTGACTGAGCATCGACATGCCATTGTCAGGGTCCTCGACGACCTCGAGGCGCGTAAGAGCCGCTCCATGATTGGA
GAGCAACCGGCTGGCCCTGTGGCTGAGTACAAGGGAATTTCCATTGGACCGCCCCCCTCGACTCAGTCATCTCCG
GGGTCGTCACTGGCTCGTTCTCGTGACCGGACTACCGGGCTGGGACACTCGAGGGCCCGCTCATTTGCGGTACGA
CGACCCCAGGCCCGCATCGTTGAGCTGCTCATGGATCTCTGTGATACCGCCATTGAAATCAGCAGCCCTGCGATC
AAGGAGAGCTCAGCGCTGCAGGAAGATGGCGAGATTCGCACCCAATCGCCTCAGTCAGAGTCACGAATCTGCCAA
GTCATGCAGTGGCAGTCGCCGAGCACAAACACGCTGGATCAGGAGCAAGGCCTGGCGCTCCTTTGCTCCGACACA
GAAAGAGTTGCCAAGGCCAAGGTTGATGCCGTCTTTCGCCACCGCAAAATTCTTGAGTATGCAGAGAGGATCCGT
GTTGAGCTGGCGGTCCTGGTAGAAGCCTGCGTCGATAGTGCTATGAAAAAGGCAGCCCGTGTGGCGGCGGGGAGG
CTGAGCGATTCCTCGGACTCTGAGGGGGAATCAAGCCAGGGCGAAAGAGAGCTTGAGACGCAGCCTGGAGCTGGG
CTGCAACCCGAAGAGGCTGATGATGTTGTCGCGGATCCAACAAGGGCTGGCGAGGAGTGTCGTGGCCGCTCCGCA
GAAGGTCAGGCGAGACCAGGGCAAACAACGGACGGTTCGTCAGCCTTGGCCACTGCGCTGCGACAGATGGACTTG
TCTGCTGCTTCTAGTCGATCTCGCTCTCGCCCGACATCTTTTGTGGCATCAACGCGGTCCAGCAGTCCCAGGGAG
TGTGCGACTCCGCGCTCTCATGCTGACGGAGGTTTAATGCGAGACTTGCGTCGAGGATCATCGCTTTCGCATGAG
ACTGAAATTGCTGATAGCGAGGGAAGCTTGCGGTCGTCGTCGGTTACTTCGCGACATGCTGCGCCTCGGATGGAA
TCGCCCATTCCAGAACTCGGAGATCTCAGACGCGCAGCAAGTGCCAGGCAGCATCACCGGCAAAGCCTCATCATA
CCAGGCACCTCGTCTCCACACCGCCAAGAATCCCCATCGCGCGCCGCACAACCGTCATCGCCGTTGCGTATCAAG
CCGAGGATCCTGCCCGTCTCTCACGAGGGAGTCGTCTCGCCCGAAGCCTCTCCCATGTTTCCCAGTAGCGAGTTT
AGTTCTCCAATCTCGCATCCTGTTCGACACCACAGGCGGCAGTCGTCGGCTGCCATTTCAGACCTGGCCATGAGA
GCTCCTCCCTCACCACGGCTAAGCGCCTCACAGGCGCCGCCGCAACCCCGGCCGGCGCAGCCCTCTATCAAGGAT
TTTGAAATCATCAAGCCAATTAGCAAGGGGGCTTTTGGCAGCGTCTACCTGTCCAAGAAGAAGTCGACTGGCGAG
TATTTCGCCATCAAGGTGCTCAAAAAGGCCGACATGGTTGCCAAAAATCAGGTGGGCAACGTCAAGGCGGAACGC
GCCATCATGATGTGGCAGGGACAAAGCGACTTTGTTGCCAAGCTCTACTGGACTTTTTCGAGCAAAGATTACCTC
TATTTGGTAATGGAATATCTCAACGGTGGCGACTGTGCTTCCCTCATCAAGGTTCTTGGGGGCCTCCCCGAGGAC
TGGGTCAAGAAGTATCTGGGCGAGGTTATTTTGGGCGTTGAGCATCTTCACGAGAGGGATATTATACATCGAGAC
CTCAAGCCAGACAACTTGCTTATTGATCAAAAGGGCCATCTCAAGCTGACTGATTTTGGCCTTTCACGAATGGGT
CTAGTTGGTCGGCAGAAGCGGGCGCTCAACAGCGAGACTGCTGAGACTACACCCGACCTGCTAAAGCAGGGGCCC
TTTGCTCGCTCCACGTCAATGGCCTCGTCGCGGTCTACATCGCTTGACCTTCAGGGACACTCCAACTCACCTGGT
GCAACGCCTCAGGTTACACCAGAAAGCGGCTCTGTCAGTCAGCCTGGCCTCTTCAGTCTTGGGTCTTTGCAGCAA
GAACCGCGACGAGTCTCGAGTAGCCATTGCAGCGATAGCGGAGGCAGCGAGGTCCTGAGCAATATGCTAACTTCA
CTATCAATCCACGAATCGGATGCCGCAGGTCAATCTGCTAATAGCAGTGCCAAAATTGCATGTGAAGACGATGCA
GTGGCGCAGAGTTCACCAGACTTGACGGCGCACCAAGGCGGCTTTAGAATTAGCGTCGACAATCACACACGCAAC
TCATTGCCGCAGTCAAGCATGATGCCTCCCCCAATGGCACTCTTTGATCCTCAGGACACAAATCGACGCTTTGTT
GGCACGCCCGACTATCTAGCTCCCGAGACCATCAAAGGCGACAAGCAAGACGAAACAAGCGACTGGTGGTCAGTG
GGCTGCATCATGTTTGAGTTTCTATATGGCATCCCTCCCTTCCACGCGGGTGAAGCGGAGCAGGTCTTTGACAAT
ATTTTGGCACGCAACATTCAATGGCCAGACGCGTCGACTTGCGAGGCGGTTTCGGACGAGGCCAAAGACGTCATC
AACAAGCTACTATGCATGGATCCGAAGCAGAGACTGGGTGCCAACCGCGATGACAAGTTTGCATCTGGCGGGGAA
GAGATTCGAAGCCACGCGTGGTTTCAGGGCATTAGCTGGCAAACCTTGCTGGAGGACGAGGCCCAGTTTGTGCCG
CAGCTGGAGAATCCAGAAGACACGGAGTACTTTGACGCCAGAGGCGCTGTCCTCCAGTCCTTTGCTGAGGAGATG
GAGGACCAAATGTCGCCTCAGTCGTCAACGGCAGGCTCCGACTATCCCGATCGGCCGCACGATGCCCTGTCACGA
GTCAGGTCTCAGGTGAATTCGATGAGCCGCAAGCTGATGCCTCTCCACATTCCGCCCCACGTGCGAGATCTCAAG
TCACGCAGGCTGAGCGAGCCGGTGGCCACGGACGACTTTGGGTCCTTTACCTTTAAGAACCTGCCGGTGCTGGAA
AAGGCCAACAAGGATGTCATTCAGAAGCTGCGAGCAGATGCGCTAGCGACGCAGAGCAAGTTGTCGGCCGCTAGT
CCTGGGCCAAGCGCCAGTGCCGCATCGCCTGCTCCATCGTTGGATGCCAGTCCCATCTTTTCGGGCCACTTGCAC
AGGACGATATCGAATGCAAAGGCGGGCAACAGGCCACAGTCGCCGTCTGGGCTCAGCCACTCCAACTCGTCTCCC
AGCCGGGCGTCGCAGCCCTCGTCACCGCTCATGGTGTCGTTTGTAGCCGGCCAGGGCGGCGAGGGGCGGAGAAAG
GCCTCGAGCAACTCGTCGAGCCTCTCTCACCAGTCTTCGTCAGTGCAGGCGTCGGCGACGGTTGACGTGCCCAAA
GTGCCGCCCAGCCTGCAAAAGGCGGCCACGTCGGTGGCGGCCATGTCGCCCATCAAGGGGCGGGGAACGACGCCG
GCGCCGCTGCCTCTTTCGCCGCAGAAAATGATTGCCACGCCGCGCCAAGGCAGCACCTCGTCGACGAGCCGGTCT
CGGTCGCTCACGGTGGGCTCCCAAGAGGCCAGTCCCATTACCTCGGACATGATACACCCTCATCGCAATCGCCGC
AGCCAGGTCTTTGACATGTCGCCCTCGTCGTCGGACAATGAGGGAGACAAGCACAACGCGCTGTTGCGTGTGCAA
CGACGCCGGCAGAGCTCAAGACGCCTCTCTCAAATAGCCTTTGACGGAGGACCAACTTTTCGGCCTCTGGACGTG
CTCATTTGCGAGGACCACCCCGTCTCGCGCATGGTTATGGAGAAGCTGCTGGAGAAGCTGCGCTGCCGCACCATT
TCAGTGGCCAATGGCTCAGAGGCGGTGCGCTATTCGCTCAGCGAGATACAATTCGACGCCATCTTTCTCGAGTTC
AAACTGCCACAGATTAATGGCGCCGATGTGGCGCGCATGATACGCGAAACCAAAAACGCAAACTCTCACACGCCA
ATTGTGGCCATTACAGCCTACCTCAAGGAGCTCCAAGCTCCGCACTATTTTGATTCTCTGGTGGAGAAGCCTATT
AGTTCATCAAAGCTGTCTGAAGTGTTGAGCAGCCTCTGCCAATGGCGGCCCGACTCACCACAGAGGGCGGCTTCG
GGCCCCCTGCCGCATCCGATTCATATTGGCTTGAAAAAGACGGCCTCCCGAACAGACGACAGCCCACCGTCGAGC
CTGTCTGCTTTTGCGGGCCGGTTTGGCTCGGCGGTGGTTTCGAGCCGGGATGAGTCCATGTCGTCGAGTCTGTTT
GGCGACGCAGAGTTGGTGACGAGTGACGACATGGCCTTGACGCTGAGCAGGAAGACGACGGGCGATTGGGACGTG
ACGGACGCAACACAGGAGCTTGTTTGTGCAGGCCCTAGCAGCCGGGGTATGCCGGTGCTGGTGGCTCAACAGTCT
GCTCCAGGGCAGATTGAGCACCTGGCACGTATTCAGAATAAGCGCGAGGGTGTGGGGAGAAGGACAATTGAATGC
ACCGAGTCTGCGGATGACGAGGACGATGAGGCTGATGCAGCAATACGAGACAGTCATGTGCGGCGGAGCAGCAAG
GCAACGGCTGGAAAAGCGGTATTTCCCAGTTCCAAGCTGGCTATTGAGATGATGCGCGCCGACAGTCACGACAGC
GTTGTTGTCAGCTCGGACAACACATCCGAGGTTGCTACGCAGGTGGCGACGACTCCGTCATTGGCCATGGCTACG
CCAATGCTGTGGGCAGTTGGTGAGGATGATGCCAAGCGCGCCCCTCCTGAGGAGGACACGTCGGAAGCGCATGGC
GGACCAGGACCAGTGGCGGCCGCAGCAGATGATGAGGAGGAGAGGAAAGCAAGATGCGAAGGCATGGATGCAACG
CCACGACCGAGTGCACTGGCCCGGCTGCAGGAGACATGCGAGGCCGGAGACGACGAGGCGACGCCGAGAGCGTGT
GGCAAGTAA
Transcript >OphauB2|2410
ATGGACCGCCCCGTGGCCTCGCTGGCGCCACCGGCCGTGGCTTCGCTCAGGGCCCAACATGGCGGCATGATGGAA
AGGTCTTTGAGTCAGGACATACGAGAGGAGCGAGAAGAGCTCCGTGAGGCCGCAGAGCAGACACTCAACGCAATT
GTCGACCTTAACCTCGATGGCACCATCAGATGGGTTAGTCCGTCATGGACCGATGTCATTGGCACACCTTTCGAA
GCGGTCAACGGCATTCCAATCACTGATCTGATTGTCAGCGACAACAAGACTGTTTTCTCAGATGTTGTCGACTCA
ATGAAGCGCGATGACTCCAAGAGCTACCGTGTTAGTTTTGTCATTCAATTGGGCCCACTCTCCAAGCTACAGTCC
ATGGACGCCATTGCCTCGACTGAAGCCCAGACCAGTCAGCTTGAAGCCCAAGGCATCATGGTGTACGACAGTGCC
TCTGGTGGAGAGAGTCATACCATGTGGATGCTTCGTCCGTGGTCTGGGCCGCACGAGATCAAAATTGATCTGCCC
CAAGTCATTGTAGATTCGCTTGGCTCAGGCGCCGAGATTCTTGCCAGCTATCTCACACAGCTGGCTGATTCGGCA
GGCGACGAGTCTTGTTCGCGCGAGCCCCCTCCCTGGGTCCTCTGCCGCATTTGTGAGCGCCAGATACAACCCTGG
TGGTTTGAAAAACACACCGATTTATGCCTACAGGAACATCGTGCCGAGATGGATGTTCAAATGGCGCAAGAGAAC
CTGACTGAGCATCGACATGCCATTGTCAGGGTCCTCGACGACCTCGAGGCGCGTAAGAGCCGCTCCATGATTGGA
GAGCAACCGGCTGGCCCTGTGGCTGAGTACAAGGGAATTTCCATTGGACCGCCCCCCTCGACTCAGTCATCTCCG
GGGTCGTCACTGGCTCGTTCTCGTGACCGGACTACCGGGCTGGGACACTCGAGGGCCCGCTCATTTGCGGTACGA
CGACCCCAGGCCCGCATCGTTGAGCTGCTCATGGATCTCTGTGATACCGCCATTGAAATCAGCAGCCCTGCGATC
AAGGAGAGCTCAGCGCTGCAGGAAGATGGCGAGATTCGCACCCAATCGCCTCAGTCAGAGTCACGAATCTGCCAA
GTCATGCAGTGGCAGTCGCCGAGCACAAACACGCTGGATCAGGAGCAAGGCCTGGCGCTCCTTTGCTCCGACACA
GAAAGAGTTGCCAAGGCCAAGGTTGATGCCGTCTTTCGCCACCGCAAAATTCTTGAGTATGCAGAGAGGATCCGT
GTTGAGCTGGCGGTCCTGGTAGAAGCCTGCGTCGATAGTGCTATGAAAAAGGCAGCCCGTGTGGCGGCGGGGAGG
CTGAGCGATTCCTCGGACTCTGAGGGGGAATCAAGCCAGGGCGAAAGAGAGCTTGAGACGCAGCCTGGAGCTGGG
CTGCAACCCGAAGAGGCTGATGATGTTGTCGCGGATCCAACAAGGGCTGGCGAGGAGTGTCGTGGCCGCTCCGCA
GAAGGTCAGGCGAGACCAGGGCAAACAACGGACGGTTCGTCAGCCTTGGCCACTGCGCTGCGACAGATGGACTTG
TCTGCTGCTTCTAGTCGATCTCGCTCTCGCCCGACATCTTTTGTGGCATCAACGCGGTCCAGCAGTCCCAGGGAG
TGTGCGACTCCGCGCTCTCATGCTGACGGAGGTTTAATGCGAGACTTGCGTCGAGGATCATCGCTTTCGCATGAG
ACTGAAATTGCTGATAGCGAGGGAAGCTTGCGGTCGTCGTCGGTTACTTCGCGACATGCTGCGCCTCGGATGGAA
TCGCCCATTCCAGAACTCGGAGATCTCAGACGCGCAGCAAGTGCCAGGCAGCATCACCGGCAAAGCCTCATCATA
CCAGGCACCTCGTCTCCACACCGCCAAGAATCCCCATCGCGCGCCGCACAACCGTCATCGCCGTTGCGTATCAAG
CCGAGGATCCTGCCCGTCTCTCACGAGGGAGTCGTCTCGCCCGAAGCCTCTCCCATGTTTCCCAGTAGCGAGTTT
AGTTCTCCAATCTCGCATCCTGTTCGACACCACAGGCGGCAGTCGTCGGCTGCCATTTCAGACCTGGCCATGAGA
GCTCCTCCCTCACCACGGCTAAGCGCCTCACAGGCGCCGCCGCAACCCCGGCCGGCGCAGCCCTCTATCAAGGAT
TTTGAAATCATCAAGCCAATTAGCAAGGGGGCTTTTGGCAGCGTCTACCTGTCCAAGAAGAAGTCGACTGGCGAG
TATTTCGCCATCAAGGTGCTCAAAAAGGCCGACATGGTTGCCAAAAATCAGGTGGGCAACGTCAAGGCGGAACGC
GCCATCATGATGTGGCAGGGACAAAGCGACTTTGTTGCCAAGCTCTACTGGACTTTTTCGAGCAAAGATTACCTC
TATTTGGTAATGGAATATCTCAACGGTGGCGACTGTGCTTCCCTCATCAAGGTTCTTGGGGGCCTCCCCGAGGAC
TGGGTCAAGAAGTATCTGGGCGAGGTTATTTTGGGCGTTGAGCATCTTCACGAGAGGGATATTATACATCGAGAC
CTCAAGCCAGACAACTTGCTTATTGATCAAAAGGGCCATCTCAAGCTGACTGATTTTGGCCTTTCACGAATGGGT
CTAGTTGGTCGGCAGAAGCGGGCGCTCAACAGCGAGACTGCTGAGACTACACCCGACCTGCTAAAGCAGGGGCCC
TTTGCTCGCTCCACGTCAATGGCCTCGTCGCGGTCTACATCGCTTGACCTTCAGGGACACTCCAACTCACCTGGT
GCAACGCCTCAGGTTACACCAGAAAGCGGCTCTGTCAGTCAGCCTGGCCTCTTCAGTCTTGGGTCTTTGCAGCAA
GAACCGCGACGAGTCTCGAGTAGCCATTGCAGCGATAGCGGAGGCAGCGAGGTCCTGAGCAATATGCTAACTTCA
CTATCAATCCACGAATCGGATGCCGCAGGTCAATCTGCTAATAGCAGTGCCAAAATTGCATGTGAAGACGATGCA
GTGGCGCAGAGTTCACCAGACTTGACGGCGCACCAAGGCGGCTTTAGAATTAGCGTCGACAATCACACACGCAAC
TCATTGCCGCAGTCAAGCATGATGCCTCCCCCAATGGCACTCTTTGATCCTCAGGACACAAATCGACGCTTTGTT
GGCACGCCCGACTATCTAGCTCCCGAGACCATCAAAGGCGACAAGCAAGACGAAACAAGCGACTGGTGGTCAGTG
GGCTGCATCATGTTTGAGTTTCTATATGGCATCCCTCCCTTCCACGCGGGTGAAGCGGAGCAGGTCTTTGACAAT
ATTTTGGCACGCAACATTCAATGGCCAGACGCGTCGACTTGCGAGGCGGTTTCGGACGAGGCCAAAGACGTCATC
AACAAGCTACTATGCATGGATCCGAAGCAGAGACTGGGTGCCAACCGCGATGACAAGTTTGCATCTGGCGGGGAA
GAGATTCGAAGCCACGCGTGGTTTCAGGGCATTAGCTGGCAAACCTTGCTGGAGGACGAGGCCCAGTTTGTGCCG
CAGCTGGAGAATCCAGAAGACACGGAGTACTTTGACGCCAGAGGCGCTGTCCTCCAGTCCTTTGCTGAGGAGATG
GAGGACCAAATGTCGCCTCAGTCGTCAACGGCAGGCTCCGACTATCCCGATCGGCCGCACGATGCCCTGTCACGA
GTCAGGTCTCAGGTGAATTCGATGAGCCGCAAGCTGATGCCTCTCCACATTCCGCCCCACGTGCGAGATCTCAAG
TCACGCAGGCTGAGCGAGCCGGTGGCCACGGACGACTTTGGGTCCTTTACCTTTAAGAACCTGCCGGTGCTGGAA
AAGGCCAACAAGGATGTCATTCAGAAGCTGCGAGCAGATGCGCTAGCGACGCAGAGCAAGTTGTCGGCCGCTAGT
CCTGGGCCAAGCGCCAGTGCCGCATCGCCTGCTCCATCGTTGGATGCCAGTCCCATCTTTTCGGGCCACTTGCAC
AGGACGATATCGAATGCAAAGGCGGGCAACAGGCCACAGTCGCCGTCTGGGCTCAGCCACTCCAACTCGTCTCCC
AGCCGGGCGTCGCAGCCCTCGTCACCGCTCATGGTGTCGTTTGTAGCCGGCCAGGGCGGCGAGGGGCGGAGAAAG
GCCTCGAGCAACTCGTCGAGCCTCTCTCACCAGTCTTCGTCAGTGCAGGCGTCGGCGACGGTTGACGTGCCCAAA
GTGCCGCCCAGCCTGCAAAAGGCGGCCACGTCGGTGGCGGCCATGTCGCCCATCAAGGGGCGGGGAACGACGCCG
GCGCCGCTGCCTCTTTCGCCGCAGAAAATGATTGCCACGCCGCGCCAAGGCAGCACCTCGTCGACGAGCCGGTCT
CGGTCGCTCACGGTGGGCTCCCAAGAGGCCAGTCCCATTACCTCGGACATGATACACCCTCATCGCAATCGCCGC
AGCCAGGTCTTTGACATGTCGCCCTCGTCGTCGGACAATGAGGGAGACAAGCACAACGCGCTGTTGCGTGTGCAA
CGACGCCGGCAGAGCTCAAGACGCCTCTCTCAAATAGCCTTTGACGGAGGACCAACTTTTCGGCCTCTGGACGTG
CTCATTTGCGAGGACCACCCCGTCTCGCGCATGGTTATGGAGAAGCTGCTGGAGAAGCTGCGCTGCCGCACCATT
TCAGTGGCCAATGGCTCAGAGGCGGTGCGCTATTCGCTCAGCGAGATACAATTCGACGCCATCTTTCTCGAGTTC
AAACTGCCACAGATTAATGGCGCCGATGTGGCGCGCATGATACGCGAAACCAAAAACGCAAACTCTCACACGCCA
ATTGTGGCCATTACAGCCTACCTCAAGGAGCTCCAAGCTCCGCACTATTTTGATTCTCTGGTGGAGAAGCCTATT
AGTTCATCAAAGCTGTCTGAAGTGTTGAGCAGCCTCTGCCAATGGCGGCCCGACTCACCACAGAGGGCGGCTTCG
GGCCCCCTGCCGCATCCGATTCATATTGGCTTGAAAAAGACGGCCTCCCGAACAGACGACAGCCCACCGTCGAGC
CTGTCTGCTTTTGCGGGCCGGTTTGGCTCGGCGGTGGTTTCGAGCCGGGATGAGTCCATGTCGTCGAGTCTGTTT
GGCGACGCAGAGTTGGTGACGAGTGACGACATGGCCTTGACGCTGAGCAGGAAGACGACGGGCGATTGGGACGTG
ACGGACGCAACACAGGAGCTTGTTTGTGCAGGCCCTAGCAGCCGGGGTATGCCGGTGCTGGTGGCTCAACAGTCT
GCTCCAGGGCAGATTGAGCACCTGGCACGTATTCAGAATAAGCGCGAGGGTGTGGGGAGAAGGACAATTGAATGC
ACCGAGTCTGCGGATGACGAGGACGATGAGGCTGATGCAGCAATACGAGACAGTCATGTGCGGCGGAGCAGCAAG
GCAACGGCTGGAAAAGCGGTATTTCCCAGTTCCAAGCTGGCTATTGAGATGATGCGCGCCGACAGTCACGACAGC
GTTGTTGTCAGCTCGGACAACACATCCGAGGTTGCTACGCAGGTGGCGACGACTCCGTCATTGGCCATGGCTACG
CCAATGCTGTGGGCAGTTGGTGAGGATGATGCCAAGCGCGCCCCTCCTGAGGAGGACACGTCGGAAGCGCATGGC
GGACCAGGACCAGTGGCGGCCGCAGCAGATGATGAGGAGGAGAGGAAAGCAAGATGCGAAGGCATGGATGCAACG
CCACGACCGAGTGCACTGGCCCGGCTGCAGGAGACATGCGAGGCCGGAGACGACGAGGCGACGCCGAGAGCGTGT
GGCAAGTAA
Gene >OphauB2|2410
ATGGACCGCCCCGTGGCCTCGCTGGCGCCACCGGCCGTGGCTTCGCTCAGGGCCCAACATGGCGGCATGATGGAA
AGGTCTTTGAGTCAGGACATACGAGAGGAGCGAGAAGAGCTCCGTGAGGCCGCAGAGCAGACACTCAACGCAATT
GTCGACCTTAACCTCGATGGCACCATCAGATGGGTTAGTCCGTCATGGACCGATGTCATTGGCACACCTTTCGAA
GCGGTCAACGGCATTCCAATCACTGATCTGATTGTCAGCGACAACAAGACTGTTTTCTCAGATGTTGTCGACTCA
ATGAAGCGCGATGACTCCAAGAGCTACCGTGTTAGTTTTGTCATTCAATTGGGCCCACTCTCCAAGCTACAGTCC
ATGGACGCCATTGCCTCGACTGAAGCCCAGACCAGTCAGCTTGAAGCCCAAGGCATCATGGTGTACGACAGTGCC
TCTGGTGGAGAGAGTCATGTTAGTTTGAAGCCAACTCCCAGACCAATGCCTCCGCTAATGAGACTCACCACGTCC
AGACCATGTGGATGCTTCGTCCGTGGTCTGGGCCGCACGAGATCAAAATTGATCTGCCCCAAGTCATTGTAGATT
CGCTTGGCTCAGGCGCCGAGATTCTTGCCAGCTATCTCACACAGCTGGCTGATTCGGCAGGCGACGAGTCTTGTT
CGCGCGAGCCCCCTCCCTGGGTCCTCTGCCGCATTTGTGAGCGCCAGATACAACCCTGGTGGTTTGAAAAACACA
CCGATTTATGCCTACAGGAACATCGTGCCGAGATGGATGTTCAAATGGCGCAAGAGAACCTGACTGAGCATCGAC
ATGCCATTGTCAGGGTCCTCGACGACCTCGAGGCGCGTAAGAGCCGCTCCATGATTGGAGAGCAACCGGCTGGCC
CTGTGGCTGAGTACAAGGGAATTTCCATTGGACCGCCCCCCTCGACTCAGTCATCTCCGGGGTCGTCACTGGCTC
GTTCTCGTGACCGGACTACCGGGCTGGGACACTCGAGGGCCCGCTCATTTGCGGTACGACGACCCCAGGCCCGCA
TCGTTGAGCTGCTCATGGATCTCTGTGATACCGCCATTGAAATCAGCAGCCCTGCGATCAAGGAGAGCTCAGCGC
TGCAGGAAGATGGCGAGATTCGCACCCAATCGCCTCAGTCAGAGTCACGAATCTGCCAAGTCATGCAGTGGCAGT
CGCCGAGCACAAACACGCTGGATCAGGAGCAAGGCCTGGCGCTCCTTTGCTCCGACACAGAAAGAGTTGCCAAGG
CCAAGGTTGATGCCGTCTTTCGCCACCGCAAAATTCTTGAGTATGCAGAGAGGATCCGTGTTGAGCTGGCGGTCC
TGGTAGAAGCCTGCGTCGATAGTGCTATGAAAAAGGCAGCCCGTGTGGCGGCGGGGAGGCTGAGCGATTCCTCGG
ACTCTGAGGGGGAATCAAGCCAGGGCGAAAGAGAGCTTGAGACGCAGCCTGGAGCTGGGCTGCAACCCGAAGAGG
CTGATGATGTTGTCGCGGATCCAACAAGGGCTGGCGAGGAGTGTCGTGGCCGCTCCGCAGAAGGTCAGGCGAGAC
CAGGGCAAACAACGGACGGTTCGTCAGCCTTGGCCACTGCGCTGCGACAGATGGACTTGTCTGCTGCTTCTAGTC
GATCTCGCTCTCGCCCGACATCTTTTGTGGCATCAACGCGGTCCAGCAGTCCCAGGGAGTGTGCGACTCCGCGCT
CTCATGCTGACGGAGGTTTAATGCGAGACTTGCGTCGAGGATCATCGCTTTCGCATGAGACTGAAATTGCTGATA
GCGAGGGAAGCTTGCGGTCGTCGTCGGTTACTTCGCGACATGCTGCGCCTCGGATGGAATCGCCCATTCCAGAAC
TCGGAGATCTCAGACGCGCAGCAAGTGCCAGGCAGCATCACCGGCAAAGCCTCATCATACCAGGCACCTCGTCTC
CACACCGCCAAGAATCCCCATCGCGCGCCGCACAACCGTCATCGCCGTTGCGTATCAAGCCGAGGATCCTGCCCG
TCTCTCACGAGGGAGTCGTCTCGCCCGAAGCCTCTCCCATGTTTCCCAGTAGCGAGTTTAGTTCTCCAATCTCGC
ATCCTGTTCGACACCACAGGCGGCAGTCGTCGGCTGCCATTTCAGACCTGGCCATGAGAGCTCCTCCCTCACCAC
GGCTAAGCGCCTCACAGGCGCCGCCGCAACCCCGGCCGGCGCAGCCCTCTATCAAGGATTTTGAAATCATCAAGC
CAATTAGCAAGGGGGCTTTTGGCAGCGTCTACCTGTCCAAGAAGAAGTCGACTGGCGAGTATTTCGCCATCAAGG
TGCTCAAAAAGGCCGACATGGTTGCCAAAAATCAGGTGGGCAACGTCAAGGCGGAACGCGCCATCATGATGTGGC
AGGGACAAAGCGACTTTGTTGCCAAGCTCTACTGGACTTTTTCGAGCAAAGATTACCTCTATTTGGTAATGGAAT
ATCTCAACGGTGGCGACTGTGCTTCCCTCATCAAGGTTCTTGGGGGCCTCCCCGAGGACTGGGTCAAGAAGTATC
TGGGCGAGGTTATTTTGGGCGTTGAGCATCTTCACGAGAGGGATATTATACATCGAGACCTCAAGCCAGACAACT
TGCTTATTGATCAAAAGGGCCATCTCAAGCTGACTGATTTTGGCCTTTCACGAATGGGTCTAGTTGGTCGGCAGA
AGCGGGCGCTCAACAGCGAGACTGCTGAGACTACACCCGACCTGCTAAAGCAGGGGCCCTTTGCTCGCTCCACGT
CAATGGCCTCGTCGCGGTCTACATCGCTTGACCTTCAGGGACACTCCAACTCACCTGGTGCAACGCCTCAGGTTA
CACCAGAAAGCGGCTCTGTCAGTCAGCCTGGCCTCTTCAGTCTTGGGTCTTTGCAGCAAGAACCGCGACGAGTCT
CGAGTAGCCATTGCAGCGATAGCGGAGGCAGCGAGGTCCTGAGCAATATGCTAACTTCACTATCAATCCACGAAT
CGGATGCCGCAGGTCAATCTGCTAATAGCAGTGCCAAAATTGCATGTGAAGACGATGCAGTGGCGCAGAGTTCAC
CAGACTTGACGGCGCACCAAGGCGGCTTTAGAATTAGCGTCGACAATCACACACGCAACTCATTGCCGCAGTCAA
GCATGATGCCTCCCCCAATGGCACTCTTTGATCCTCAGGACACAAATCGACGCTTTGTTGGCACGCCCGACTATC
TAGCTCCCGAGACCATCAAAGGCGACAAGCAAGACGAAACAAGCGACTGGTGGTCAGTGGGCTGCATCATGTTTG
AGTTTCTATATGGCATCCCTCCCTTCCACGCGGGTGAAGCGGAGCAGGTCTTTGACAATATTTTGGCACGCAACA
TTCAATGGCCAGACGCGTCGACTTGCGAGGCGGTTTCGGACGAGGCCAAAGACGTCATCAACAAGCTACTATGCA
TGGATCCGAAGCAGAGACTGGGTGCCAACCGCGATGACAAGTTTGCATCTGGCGGGGAAGAGATTCGAAGCCACG
CGTGGTTTCAGGGCATTAGCTGGCAAACCTTGCTGGAGGACGAGGCCCAGTTTGTGCCGCAGCTGGAGAATCCAG
AAGACACGGAGTACTTTGACGCCAGAGGCGCTGTCCTCCAGTCCTTTGCTGAGGAGATGGAGGACCAAATGTCGC
CTCAGTCGTCAACGGCAGGCTCCGACTATCCCGATCGGCCGCACGATGCCCTGTCACGAGTCAGGTCTCAGGTGA
ATTCGATGAGCCGCAAGCTGATGCCTCTCCACATTCCGCCCCACGTGCGAGATCTCAAGTCACGCAGGCTGAGCG
AGCCGGTGGCCACGGACGACTTTGGGTCCTTTACCTTTAAGAACCTGCCGGTGCTGGAAAAGGCCAACAAGGATG
TCATTCAGAAGCTGCGAGCAGATGCGCTAGCGACGCAGAGCAAGTTGTCGGCCGCTAGTCCTGGGCCAAGCGCCA
GTGCCGCATCGCCTGCTCCATCGTTGGATGCCAGTCCCATCTTTTCGGGCCACTTGCACAGGACGATATCGAATG
CAAAGGCGGGCAACAGGCCACAGTCGCCGTCTGGGCTCAGCCACTCCAACTCGTCTCCCAGCCGGGCGTCGCAGC
CCTCGTCACCGCTCATGGTGTCGTTTGTAGCCGGCCAGGGCGGCGAGGGGCGGAGAAAGGCCTCGAGCAACTCGT
CGAGCCTCTCTCACCAGTCTTCGTCAGTGCAGGCGTCGGCGACGGTTGACGTGCCCAAAGTGCCGCCCAGCCTGC
AAAAGGCGGCCACGTCGGTGGCGGCCATGTCGCCCATCAAGGGGCGGGGAACGACGCCGGCGCCGCTGCCTCTTT
CGCCGCAGAAAATGATTGCCACGCCGCGCCAAGGCAGCACCTCGTCGACGAGCCGGTCTCGGTCGCTCACGGTGG
GCTCCCAAGAGGCCAGTCCCATTACCTCGGACATGATACACCCTCATCGCAATCGCCGCAGCCAGGTCTTTGACA
TGTCGCCCTCGTCGTCGGACAATGAGGGAGACAAGCACAACGCGCTGTTGCGTGTGCAACGACGCCGGCAGAGCT
CAAGACGCCTCTCTCAAATAGCCTTTGACGGAGGACCAACTTTTCGGCCTCTGGACGTGCTCATTTGCGAGGACC
ACCCCGTCTCGCGCATGGTTATGGAGAAGCTGCTGGAGAAGCTGCGCTGCCGCACCATTTCAGTGGCCAATGGCT
CAGAGGCGGTGCGCTATTCGCTCAGCGAGATACAATTCGACGCCATCTTTCTCGAGTTCAAACTGCCACAGATTA
ATGGCGCCGATGTGGCGCGCATGATACGCGAAACCAAAAACGCAAACTCTCACACGCCAATTGTGGCCATTACAG
CCTACCTCAAGGAGCTCCAAGCTCCGCACTATTTTGATTCTCTGGTGGAGAAGCCTATTAGTTCATCAAAGCTGT
CTGAAGTGTTGAGCAGCCTCTGCCAATGGCGGCCCGACTCACCACAGAGGGCGGCTTCGGGCCCCCTGCCGCATC
CGATTCATATTGGCTTGAAAAAGACGGCCTCCCGAACAGACGACAGCCCACCGTCGAGCCTGTCTGCTTTTGCGG
GCCGGTTTGGCTCGGCGGTGGTTTCGAGCCGGGATGAGTCCATGTCGTCGAGTCTGTTTGGCGACGCAGAGTTGG
TGACGAGTGACGACATGGCCTTGACGCTGAGCAGGAAGACGACGGGCGATTGGGACGTGACGGACGCAACACAGG
AGCTTGTTTGTGCAGGCCCTAGCAGCCGGGGTATGCCGGTGCTGGTGGCTCAACAGTCTGCTCCAGGGCAGATTG
AGCACCTGGCACGTATTCAGAATAAGCGCGAGGGTGTGGGGAGAAGGACAATTGAATGCACCGAGTCTGCGGATG
ACGAGGACGATGAGGCTGATGCAGCAATACGAGACAGTCATGTGCGGCGGAGCAGCAAGGCAACGGCTGGAAAAG
CGGTATTTCCCAGTTCCAAGCTGGCTATTGAGATGATGCGCGCCGACAGTCACGACAGCGTTGTTGTCAGCTCGG
ACAACACATCCGAGGTTGCTACGCAGGTGGCGACGACTCCGTCATTGGCCATGGCTACGCCAATGCTGTGGGCAG
TTGGTGAGGATGATGCCAAGCGCGCCCCTCCTGAGGAGGACACGTCGGAAGCGCATGGCGGACCAGGACCAGTGG
CGGCCGCAGCAGATGATGAGGAGGAGAGGAAAGCAAGATGCGAAGGCATGGATGCAACGCCACGACCGAGTGCAC
TGGCCCGGCTGCAGGAGACATGCGAGGCCGGAGACGACGAGGCGACGCCGAGAGCGTGTGGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail