Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2405
Gene name
LocationContig_175:14155..16657
Strand+
Gene length (bp)2502
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14604 SH3_9 Variant SH3 domain 9.9E-11 649 696
PF14604 SH3_9 Variant SH3 domain 6.9E-16 731 779
PF00018 SH3_1 SH3 domain 2.3E-10 649 692
PF00018 SH3_1 SH3 domain 3.0E-13 731 775
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 9.7E-16 57 150
PF07653 SH3_2 Variant SH3 domain 3.4E-05 650 697
PF07653 SH3_2 Variant SH3 domain 1.9E-05 731 779

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 3 166 3.0E-32
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 3 165 2.0E-31
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 5 192 6.0E-31
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 3 179 7.0E-31
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 3 179 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 3 166 3.0E-32
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 3 165 2.0E-31
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 5 192 6.0E-31
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 3 179 7.0E-31
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 3 179 7.0E-26
sp|Q62418|DBNL_MOUSE Drebrin-like protein OS=Mus musculus GN=Dbnl PE=1 SV=2 3 192 1.0E-25
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 4 166 1.0E-23
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 59 157 1.0E-17
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 638 779 2.0E-17
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 63 422 2.0E-16
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 638 780 1.0E-15
sp|Q557J6|DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum GN=abpE-1 PE=2 SV=1 1 192 5.0E-15
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 62 432 5.0E-15
sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens GN=CTTN PE=1 SV=2 703 782 7.0E-14
sp|Q66HL2|SRC8_RAT Src substrate cortactin OS=Rattus norvegicus GN=Cttn PE=1 SV=1 721 782 8.0E-14
sp|Q60598|SRC8_MOUSE Src substrate cortactin OS=Mus musculus GN=Cttn PE=1 SV=2 721 782 1.0E-13
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 729 780 3.0E-13
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 729 780 3.0E-13
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 646 779 3.0E-13
sp|Q01406|SRC8_CHICK Src substrate protein p85 OS=Gallus gallus GN=CTTN1 PE=1 SV=1 703 782 4.0E-13
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 642 781 4.0E-13
sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 645 779 4.0E-13
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 642 781 1.0E-12
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 646 779 1.0E-12
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 645 779 1.0E-12
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 658 780 2.0E-12
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 645 779 2.0E-12
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 642 781 2.0E-12
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 649 782 3.0E-12
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 677 780 3.0E-12
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 677 780 4.0E-12
sp|Q16643|DREB_HUMAN Drebrin OS=Homo sapiens GN=DBN1 PE=1 SV=4 1 153 4.0E-12
sp|Q07266|DREB_RAT Drebrin OS=Rattus norvegicus GN=Dbn1 PE=1 SV=3 1 153 4.0E-12
sp|Q9QXS6|DREB_MOUSE Drebrin OS=Mus musculus GN=Dbn1 PE=1 SV=4 1 153 6.0E-12
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 642 779 8.0E-12
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 645 697 1.0E-11
sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens GN=CD2AP PE=1 SV=1 646 779 2.0E-11
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 658 780 3.0E-11
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 637 698 4.0E-11
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 645 782 5.0E-11
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 642 779 6.0E-11
sp|Q99M51|NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus GN=Nck1 PE=1 SV=1 645 782 8.0E-11
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 658 780 1.0E-10
sp|P16333|NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens GN=NCK1 PE=1 SV=1 645 782 2.0E-10
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 658 780 2.0E-10
sp|Q69ZI1|SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus GN=Sh3rf1 PE=1 SV=2 649 781 2.0E-10
sp|P18302|DREB_CHICK Drebrin OS=Gallus gallus GN=DBN1 PE=2 SV=4 1 153 2.0E-10
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 726 780 3.0E-10
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 726 780 3.0E-10
sp|Q62418|DBNL_MOUSE Drebrin-like protein OS=Mus musculus GN=Dbnl PE=1 SV=2 726 780 3.0E-10
sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 649 781 3.0E-10
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 649 780 3.0E-10
sp|O43639|NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens GN=NCK2 PE=1 SV=2 645 778 3.0E-10
sp|A7E8B6|SLA1_SCLS1 Actin cytoskeleton-regulatory complex protein sla1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sla1 PE=3 SV=2 649 782 3.0E-10
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 724 780 4.0E-10
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 642 779 4.0E-10
sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 649 781 4.0E-10
sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 649 781 5.0E-10
sp|P14317|HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens GN=HCLS1 PE=1 SV=3 728 780 5.0E-10
sp|O60504|VINEX_HUMAN Vinexin OS=Homo sapiens GN=SORBS3 PE=1 SV=2 635 782 5.0E-10
sp|Q9R1Z8|VINEX_MOUSE Vinexin OS=Mus musculus GN=Sorbs3 PE=1 SV=1 637 782 5.0E-10
sp|Q99M51|NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus GN=Nck1 PE=1 SV=1 648 778 6.0E-10
sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 649 780 6.0E-10
sp|P34258|YKA7_CAEEL Uncharacterized protein B0303.7 OS=Caenorhabditis elegans GN=B0303.7 PE=1 SV=5 646 778 6.0E-10
sp|P16333|NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens GN=NCK1 PE=1 SV=1 648 778 8.0E-10
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 726 780 1.0E-09
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 645 697 1.0E-09
sp|O55033|NCK2_MOUSE Cytoplasmic protein NCK2 OS=Mus musculus GN=Nck2 PE=1 SV=1 645 778 1.0E-09
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 724 780 2.0E-09
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 593 699 2.0E-09
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 642 699 2.0E-09
sp|O43639|NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens GN=NCK2 PE=1 SV=2 645 778 2.0E-09
sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 649 781 2.0E-09
sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=1 SV=1 649 780 2.0E-09
sp|Q75JD4|Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum GN=DDB_G0271676 PE=3 SV=1 649 780 2.0E-09
sp|Q62418|DBNL_MOUSE Drebrin-like protein OS=Mus musculus GN=Dbnl PE=1 SV=2 636 699 3.0E-09
sp|Q60598|SRC8_MOUSE Src substrate cortactin OS=Mus musculus GN=Cttn PE=1 SV=2 642 697 3.0E-09
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 642 699 4.0E-09
sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens GN=CTTN PE=1 SV=2 642 697 4.0E-09
sp|Q6TXD4|DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus GN=Dnmbp PE=1 SV=2 656 780 4.0E-09
sp|Q66HL2|SRC8_RAT Src substrate cortactin OS=Rattus norvegicus GN=Cttn PE=1 SV=1 642 697 5.0E-09
sp|Q8TEJ3|SH3R3_HUMAN SH3 domain-containing RING finger protein 3 OS=Homo sapiens GN=SH3RF3 PE=1 SV=2 649 780 6.0E-09
sp|P39743|RV167_YEAST Reduced viability upon starvation protein 167 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS167 PE=1 SV=1 727 782 6.0E-09
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 639 699 7.0E-09
sp|P49710|HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus GN=Hcls1 PE=1 SV=2 732 780 7.0E-09
sp|O94868|FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens GN=FCHSD2 PE=1 SV=3 647 779 7.0E-09
sp|Q62417|SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus GN=Sorbs1 PE=1 SV=2 608 780 8.0E-09
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 724 780 1.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 642 780 1.0E-08
sp|Q6PFY1|FCSD1_MOUSE F-BAR and double SH3 domains protein 1 OS=Mus musculus GN=Fchsd1 PE=2 SV=1 645 779 1.0E-08
sp|Q3USJ8|FCSD2_MOUSE F-BAR and double SH3 domains protein 2 OS=Mus musculus GN=Fchsd2 PE=1 SV=2 647 779 1.0E-08
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 642 699 2.0E-08
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 655 779 2.0E-08
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 638 699 3.0E-08
sp|Q9BX66|SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens GN=SORBS1 PE=1 SV=3 608 780 3.0E-08
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 656 780 3.0E-08
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 642 780 4.0E-08
sp|Q59LF3|RV167_CANAL Regulator of cytoskeleton and endocytosis RVS167 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS167 PE=3 SV=1 728 780 4.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 642 780 5.0E-08
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 682 778 5.0E-08
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 649 712 7.0E-08
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 684 778 1.0E-07
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 635 780 2.0E-07
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 731 778 2.0E-07
sp|Q86WN1|FCSD1_HUMAN F-BAR and double SH3 domains protein 1 OS=Homo sapiens GN=FCHSD1 PE=1 SV=1 645 779 2.0E-07
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 655 779 3.0E-07
sp|O55033|NCK2_MOUSE Cytoplasmic protein NCK2 OS=Mus musculus GN=Nck2 PE=1 SV=1 645 778 3.0E-07
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 731 778 3.0E-07
sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens GN=SH3GL1 PE=1 SV=1 728 780 3.0E-07
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 728 780 3.0E-07
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 726 780 4.0E-07
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 637 695 4.0E-07
sp|Q2KJA1|SH3G1_BOVIN Endophilin-A2 OS=Bos taurus GN=SH3GL1 PE=2 SV=1 728 780 4.0E-07
sp|O94875|SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens GN=SORBS2 PE=1 SV=3 645 779 8.0E-07
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 731 778 8.0E-07
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 729 780 8.0E-07
sp|O75886|STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens GN=STAM2 PE=1 SV=1 731 778 9.0E-07
sp|Q3UTJ2|SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus GN=Sorbs2 PE=1 SV=2 649 780 1.0E-06
sp|P14317|HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens GN=HCLS1 PE=1 SV=3 644 699 2.0E-06
sp|P34258|YKA7_CAEEL Uncharacterized protein B0303.7 OS=Caenorhabditis elegans GN=B0303.7 PE=1 SV=5 642 778 2.0E-06
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 634 695 2.0E-06
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 634 695 2.0E-06
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 649 695 2.0E-06
sp|Q62419|SH3G1_MOUSE Endophilin-A2 OS=Mus musculus GN=Sh3gl1 PE=1 SV=1 728 780 2.0E-06
sp|Q2KJB5|NOSTN_BOVIN Nostrin OS=Bos taurus GN=NOSTRIN PE=1 SV=1 695 779 2.0E-06
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 727 780 2.0E-06
sp|O35413|SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus GN=Sorbs2 PE=1 SV=2 649 780 2.0E-06
sp|Q99MZ8|LASP1_RAT LIM and SH3 domain protein 1 OS=Rattus norvegicus GN=Lasp1 PE=1 SV=1 641 698 2.0E-06
sp|Q61792|LASP1_MOUSE LIM and SH3 domain protein 1 OS=Mus musculus GN=Lasp1 PE=1 SV=1 641 698 2.0E-06
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 731 778 2.0E-06
sp|Q3B7M5|LASP1_BOVIN LIM and SH3 domain protein 1 OS=Bos taurus GN=LASP1 PE=2 SV=1 641 698 2.0E-06
sp|O94875|SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens GN=SORBS2 PE=1 SV=3 649 780 3.0E-06
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 649 741 3.0E-06
sp|Q8N157|AHI1_HUMAN Jouberin OS=Homo sapiens GN=AHI1 PE=1 SV=1 714 778 3.0E-06
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 715 779 3.0E-06
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 649 700 3.0E-06
sp|Q14847|LASP1_HUMAN LIM and SH3 domain protein 1 OS=Homo sapiens GN=LASP1 PE=1 SV=2 641 698 3.0E-06
sp|Q5R5W0|LASP1_PONAB LIM and SH3 domain protein 1 OS=Pongo abelii GN=LASP1 PE=2 SV=1 641 698 3.0E-06
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 731 779 4.0E-06
sp|A8MVU1|NCF1C_HUMAN Putative neutrophil cytosol factor 1C OS=Homo sapiens GN=NCF1C PE=5 SV=1 650 779 4.0E-06
sp|O75791|GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens GN=GRAP2 PE=1 SV=1 729 778 4.0E-06
sp|P34121|COAA_DICDI Coactosin OS=Dictyostelium discoideum GN=coaA PE=1 SV=1 8 166 4.0E-06
sp|P20929|NEBU_HUMAN Nebulin OS=Homo sapiens GN=NEB PE=1 SV=5 720 779 4.0E-06
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 642 779 4.0E-06
sp|P49710|HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus GN=Hcls1 PE=1 SV=2 649 698 5.0E-06
sp|Q5I0D6|NOSTN_RAT Nostrin OS=Rattus norvegicus GN=Nostrin PE=1 SV=1 697 779 6.0E-06
sp|A2AAY5|SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus GN=Sh3pxd2b PE=1 SV=1 646 779 6.0E-06
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 731 779 6.0E-06
sp|O77506|LASP1_RABIT LIM and SH3 domain protein 1 OS=Oryctolagus cuniculus GN=LASP1 PE=1 SV=1 641 698 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding Yes
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1559
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5670
Ophiocordyceps australis map64 (Brazil) OphauB2|2405 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00138
Ophiocordyceps camponoti-rufipedis Ophun1|3542
Ophiocordyceps kimflemingae Ophio5|3799
Ophiocordyceps subramaniannii Hirsu2|1139

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2405
MASLNLSINGPSIKSSYNGVVNDALPASDSPTRAQWALFTVQAPLVNAFQDSGAKESILKVQSTGDGELADLIED
FSEGRVQFAFVKVKDPNTALPKCILIAWCGGGVPERTKGYFTSHTAAVAKVLHGYHVQITARSDADLEPESIMKK
VADASGAKYSAASSSSGAMPAAGRPPVKSKPVFTPTMSTTGRSVNPLVAARSRRDTNVDQDGWGDDAPPVTRTQL
ERVEPAYRPIKVNMNDLASQKAESSRLDGSTRQQDNGPNTVVKGAYQPVGKVDIAAIRAAAKQEDYRPSPVKGAY
EPVGKVDIAAIRARAQKPTEEADVDAPAPTPLADRATAFSQPSQSERIMSLPKPKVANKFGGASFAGTKAPVPGG
LGFGTPSASLPAPAATTSRTFADQGGKTPAQLWAEKKARERGASASSTGGTPSATSPIAPQPSGGWKSGYSGKSW
APVQAPGYGRSAPEDVVRQDTGDATHGTTGEGQDMSAEGVAVLKDRFKQAAPPSPQEASPASRMSPQEPQREFQT
SSTSISRPSGGFALPGLPSRPPPPTEEEQEEEYQHSEEEAASPIRVAVPVAREADAKEASTPLTEAPTPPSGDDV
PREKHLPDEEETDYSARRAAAAVAEQNLPVHQETAYQAEQGGKSALIQYDYDKAEDNEIDLIEGELVTNIDMVDE
DWWMGTNSKGESGLFPSNYVELIDDEGESAGARAPAPELETRAASHTADAGDTATAMYDYEAAEDNELSFPEDAV
ITNLEFPDEDWWFGHYDGQSGLFPANYVQLKQ*
Coding >OphauB2|2405
ATGGCCTCATTGAACTTGTCCATCAATGGGCCTTCGATAAAGAGCAGCTACAATGGTGTTGTCAACGACGCTTTG
CCCGCCTCCGACTCTCCCACCCGCGCTCAATGGGCCCTCTTTACGGTCCAGGCTCCGCTAGTGAATGCTTTTCAG
GACAGCGGCGCCAAAGAGAGCATACTCAAGGTCCAAAGCACAGGCGACGGTGAGCTTGCCGACCTAATCGAAGAC
TTCAGCGAGGGCCGAGTGCAGTTTGCCTTTGTCAAGGTCAAGGACCCAAATACCGCGCTGCCCAAATGCATCCTC
ATTGCCTGGTGCGGTGGCGGCGTGCCTGAGCGAACCAAGGGCTACTTTACCAGTCACACGGCAGCTGTTGCCAAG
GTCTTGCACGGATATCACGTTCAAATCACGGCTCGCTCCGATGCTGATCTTGAACCCGAATCCATCATGAAAAAG
GTGGCAGATGCATCTGGTGCCAAGTACTCAGCTGCTTCCTCGAGCAGCGGCGCTATGCCTGCTGCGGGACGGCCT
CCTGTTAAGTCAAAGCCCGTCTTCACTCCTACAATGTCTACTACCGGTCGCTCCGTGAATCCTCTAGTGGCAGCA
CGGTCTAGGAGAGACACTAATGTGGACCAAGATGGCTGGGGAGACGATGCTCCTCCAGTCACACGAACGCAGCTC
GAAAGAGTTGAGCCGGCCTATAGACCCATCAAAGTCAACATGAATGATCTCGCCAGCCAAAAAGCGGAGTCGTCG
CGCTTGGATGGCAGCACTCGTCAACAGGACAATGGACCGAACACCGTCGTCAAAGGAGCATATCAGCCTGTAGGC
AAAGTGGATATTGCTGCCATAAGAGCTGCCGCCAAGCAAGAAGACTATCGACCGTCGCCAGTCAAGGGAGCTTAC
GAGCCAGTGGGCAAAGTGGACATTGCTGCAATTCGTGCGAGAGCTCAGAAGCCTACTGAAGAAGCCGACGTTGAC
GCTCCTGCGCCCACCCCGCTGGCCGACAGGGCTACTGCCTTTTCCCAGCCCAGCCAGTCGGAGCGCATCATGTCC
TTGCCCAAGCCAAAGGTGGCCAACAAGTTTGGTGGAGCCAGCTTTGCTGGCACCAAGGCACCCGTACCTGGCGGC
CTTGGATTCGGCACTCCAAGTGCATCTTTGCCGGCACCCGCGGCGACAACCAGCCGCACCTTTGCTGACCAGGGG
GGGAAGACACCAGCCCAATTATGGGCCGAGAAGAAGGCGAGAGAAAGAGGAGCATCTGCTAGCAGCACTGGCGGC
ACACCGTCAGCCACGAGCCCTATTGCTCCTCAGCCAAGCGGTGGCTGGAAGAGCGGCTATTCTGGCAAAAGCTGG
GCCCCAGTGCAGGCTCCGGGCTATGGTCGCAGTGCGCCCGAAGATGTGGTTCGGCAGGATACAGGAGATGCTACC
CATGGCACTACTGGAGAGGGTCAAGACATGTCGGCTGAAGGCGTGGCTGTCCTCAAAGATCGCTTCAAGCAAGCA
GCTCCACCAAGTCCACAAGAAGCCTCTCCAGCGTCGAGGATGTCGCCGCAAGAGCCTCAACGTGAGTTCCAGACC
TCGTCAACCAGTATTTCGCGGCCCTCTGGCGGATTCGCGCTCCCAGGACTCCCCTCCCGTCCACCACCTCCCACC
GAGGAAGAGCAGGAAGAGGAATATCAACATAGCGAAGAAGAGGCAGCCTCCCCGATACGAGTAGCTGTTCCGGTT
GCGCGTGAAGCAGACGCCAAGGAAGCGAGCACGCCCCTGACAGAAGCTCCCACGCCACCCAGCGGTGATGACGTA
CCAAGGGAAAAGCATCTTCCAGACGAGGAAGAGACAGACTATAGTGCTCGCAGAGCCGCTGCTGCTGTGGCCGAG
CAGAACCTACCAGTGCATCAGGAGACTGCATATCAGGCTGAGCAGGGCGGCAAATCTGCGCTTATTCAGTACGAT
TATGACAAGGCTGAGGACAATGAAATTGACCTCATCGAGGGCGAGCTTGTGACCAATATTGACATGGTGGATGAA
GACTGGTGGATGGGTACCAACTCCAAGGGCGAAAGTGGTTTGTTTCCGAGCAACTACGTCGAGCTTATCGATGAC
GAGGGCGAGTCAGCAGGTGCGAGAGCACCGGCGCCTGAGCTTGAGACGAGGGCGGCAAGTCACACTGCGGATGCC
GGCGATACAGCAACTGCCATGTACGATTACGAAGCCGCCGAGGATAACGAGCTCAGCTTTCCAGAAGATGCAGTC
ATTACCAATCTTGAATTCCCCGACGAAGACTGGTGGTTCGGGCACTATGATGGGCAGTCTGGCCTGTTCCCTGCC
AATTATGTGCAGCTCAAACAGTGA
Transcript >OphauB2|2405
ATGGCCTCATTGAACTTGTCCATCAATGGGCCTTCGATAAAGAGCAGCTACAATGGTGTTGTCAACGACGCTTTG
CCCGCCTCCGACTCTCCCACCCGCGCTCAATGGGCCCTCTTTACGGTCCAGGCTCCGCTAGTGAATGCTTTTCAG
GACAGCGGCGCCAAAGAGAGCATACTCAAGGTCCAAAGCACAGGCGACGGTGAGCTTGCCGACCTAATCGAAGAC
TTCAGCGAGGGCCGAGTGCAGTTTGCCTTTGTCAAGGTCAAGGACCCAAATACCGCGCTGCCCAAATGCATCCTC
ATTGCCTGGTGCGGTGGCGGCGTGCCTGAGCGAACCAAGGGCTACTTTACCAGTCACACGGCAGCTGTTGCCAAG
GTCTTGCACGGATATCACGTTCAAATCACGGCTCGCTCCGATGCTGATCTTGAACCCGAATCCATCATGAAAAAG
GTGGCAGATGCATCTGGTGCCAAGTACTCAGCTGCTTCCTCGAGCAGCGGCGCTATGCCTGCTGCGGGACGGCCT
CCTGTTAAGTCAAAGCCCGTCTTCACTCCTACAATGTCTACTACCGGTCGCTCCGTGAATCCTCTAGTGGCAGCA
CGGTCTAGGAGAGACACTAATGTGGACCAAGATGGCTGGGGAGACGATGCTCCTCCAGTCACACGAACGCAGCTC
GAAAGAGTTGAGCCGGCCTATAGACCCATCAAAGTCAACATGAATGATCTCGCCAGCCAAAAAGCGGAGTCGTCG
CGCTTGGATGGCAGCACTCGTCAACAGGACAATGGACCGAACACCGTCGTCAAAGGAGCATATCAGCCTGTAGGC
AAAGTGGATATTGCTGCCATAAGAGCTGCCGCCAAGCAAGAAGACTATCGACCGTCGCCAGTCAAGGGAGCTTAC
GAGCCAGTGGGCAAAGTGGACATTGCTGCAATTCGTGCGAGAGCTCAGAAGCCTACTGAAGAAGCCGACGTTGAC
GCTCCTGCGCCCACCCCGCTGGCCGACAGGGCTACTGCCTTTTCCCAGCCCAGCCAGTCGGAGCGCATCATGTCC
TTGCCCAAGCCAAAGGTGGCCAACAAGTTTGGTGGAGCCAGCTTTGCTGGCACCAAGGCACCCGTACCTGGCGGC
CTTGGATTCGGCACTCCAAGTGCATCTTTGCCGGCACCCGCGGCGACAACCAGCCGCACCTTTGCTGACCAGGGG
GGGAAGACACCAGCCCAATTATGGGCCGAGAAGAAGGCGAGAGAAAGAGGAGCATCTGCTAGCAGCACTGGCGGC
ACACCGTCAGCCACGAGCCCTATTGCTCCTCAGCCAAGCGGTGGCTGGAAGAGCGGCTATTCTGGCAAAAGCTGG
GCCCCAGTGCAGGCTCCGGGCTATGGTCGCAGTGCGCCCGAAGATGTGGTTCGGCAGGATACAGGAGATGCTACC
CATGGCACTACTGGAGAGGGTCAAGACATGTCGGCTGAAGGCGTGGCTGTCCTCAAAGATCGCTTCAAGCAAGCA
GCTCCACCAAGTCCACAAGAAGCCTCTCCAGCGTCGAGGATGTCGCCGCAAGAGCCTCAACGTGAGTTCCAGACC
TCGTCAACCAGTATTTCGCGGCCCTCTGGCGGATTCGCGCTCCCAGGACTCCCCTCCCGTCCACCACCTCCCACC
GAGGAAGAGCAGGAAGAGGAATATCAACATAGCGAAGAAGAGGCAGCCTCCCCGATACGAGTAGCTGTTCCGGTT
GCGCGTGAAGCAGACGCCAAGGAAGCGAGCACGCCCCTGACAGAAGCTCCCACGCCACCCAGCGGTGATGACGTA
CCAAGGGAAAAGCATCTTCCAGACGAGGAAGAGACAGACTATAGTGCTCGCAGAGCCGCTGCTGCTGTGGCCGAG
CAGAACCTACCAGTGCATCAGGAGACTGCATATCAGGCTGAGCAGGGCGGCAAATCTGCGCTTATTCAGTACGAT
TATGACAAGGCTGAGGACAATGAAATTGACCTCATCGAGGGCGAGCTTGTGACCAATATTGACATGGTGGATGAA
GACTGGTGGATGGGTACCAACTCCAAGGGCGAAAGTGGTTTGTTTCCGAGCAACTACGTCGAGCTTATCGATGAC
GAGGGCGAGTCAGCAGGTGCGAGAGCACCGGCGCCTGAGCTTGAGACGAGGGCGGCAAGTCACACTGCGGATGCC
GGCGATACAGCAACTGCCATGTACGATTACGAAGCCGCCGAGGATAACGAGCTCAGCTTTCCAGAAGATGCAGTC
ATTACCAATCTTGAATTCCCCGACGAAGACTGGTGGTTCGGGCACTATGATGGGCAGTCTGGCCTGTTCCCTGCC
AATTATGTGCAGCTCAAACAGTGA
Gene >OphauB2|2405
ATGGCCTCATTGAACTTGTCCATCAATGGGCCTTCGATAAAGAGCAGCTACAATGGTGTTGTCAACGACGCTTTG
CCCGCCTCCGACTCTCCCACCCGCGCTCAATGGGCCCTCTTTACGGTCCAGGCTCCGCTAGTGAATGCTTTTCAG
GACAGCGGCGCCAAAGAGAGCATACTCAAGGTCCAAAGCACAGGCGGTAATGCTTGTTCCCCTCCTCACCAGTCC
ACCCCTGTGCAGGATTTCAAGAGGCTTGGCGCATTGCCTCGAGATACTAACCTCTTCTGCAGACGGTGAGCTTGC
CGACCTAATCGAAGACTTCAGCGAGGGCCGAGTGCAGTTTGCCTTTGTCAAGGTCAAGGACCCAAATACCGCGCT
GCCCAAATGCATCCTCATTGCCTGGTGCGGTGGCGGCGTGCCTGAGCGAACCAAGGGCTACTTTACCAGTCACAC
GGCAGCTGTTGCCAAGGTCTTGCACGGATATCACGTTCAAATCACGGCTCGCTCCGATGCTGATCTTGAACCCGA
ATCCATCATGAAAAAGGTGGCAGATGCATCTGGTGCCAAGTACTCAGCTGCTTCCTCGAGCAGCGGCGCTATGCC
TGCTGCGGGACGGCCTCCTGTTAAGTCAAAGCCCGTCTTCACTCCTACAATGTCTACTACCGGTCGCTCCGTGAA
TCCTCTAGTGGCAGCACGGTCTAGGAGAGACACTAATGTGGACCAAGATGGCTGGGGAGACGATGCTCCTCCAGT
CACACGAACGCAGCTCGAAAGAGTTGAGCCGGCCTATAGACCCATCAAAGTCAACATGAATGATCTCGCCAGCCA
AAAAGCGGAGTCGTCGCGCTTGGATGGCAGCACTCGTCAACAGGACAATGGACCGAACACCGTCGTCAAAGGAGC
ATATCAGCCTGTAGGCAAAGTGGATATTGCTGCCATAAGAGCTGCCGCCAAGCAAGAAGACTATCGACCGTCGCC
AGTCAAGGGAGCTTACGAGCCAGTGGGCAAAGTGGACATTGCTGCAATTCGTGCGAGAGCTCAGAAGCCTACTGA
AGAAGCCGACGTTGACGCTCCTGCGCCCACCCCGCTGGCCGACAGGGCTACTGCCTTTTCCCAGCCCAGCCAGTC
GGAGCGCATCATGTCCTTGCCCAAGCCAAAGGTGGCCAACAAGTTTGGTGGAGCCAGCTTTGCTGGCACCAAGGC
ACCCGTACCTGGCGGCCTTGGATTCGGCACTCCAAGTGCATCTTTGCCGGCACCCGCGGCGACAACCAGCCGCAC
CTTTGCTGACCAGGGGGGGAAGACACCAGCCCAATTATGGGCCGAGAAGAAGGCGAGAGAAAGAGGAGCATCTGC
TAGCAGCACTGGCGGCACACCGTCAGCCACGAGCCCTATTGCTCCTCAGCCAAGCGGTGGCTGGAAGAGCGGCTA
TTCTGGCAAAAGCTGGGCCCCAGTGCAGGCTCCGGGCTATGGTCGCAGTGCGCCCGAAGATGTGGTTCGGCAGGA
TACAGGAGATGCTACCCATGGCACTACTGGAGAGGGTCAAGACATGTCGGCTGAAGGCGTGGCTGTCCTCAAAGA
TCGCTTCAAGCAAGCAGCTCCACCAAGTCCACAAGAAGCCTCTCCAGCGTCGAGGATGTCGCCGCAAGAGCCTCA
ACGTGAGTTCCAGACCTCGTCAACCAGTATTTCGCGGCCCTCTGGCGGATTCGCGCTCCCAGGACTCCCCTCCCG
TCCACCACCTCCCACCGAGGAAGAGCAGGAAGAGGAATATCAACATAGCGAAGAAGAGGCAGCCTCCCCGATACG
AGTAGCTGTTCCGGTTGCGCGTGAAGCAGACGCCAAGGAAGCGAGCACGCCCCTGACAGAAGCTCCCACGCCACC
CAGCGGTGATGACGTACCAAGGGAAAAGCATCTTCCAGACGAGGAAGAGACAGACTATAGTGCTCGCAGAGCCGC
TGCTGCTGTGGCCGAGCAGAACCTACCAGTGCATCAGGAGACTGCATATCAGGCTGAGCAGGGCGGCAAATCTGC
GCTTATTCAGTACGATTATGACAAGGCTGAGGACAATGAAATTGACCTCATCGAGGGCGAGCTTGTGACCAATAT
TGACATGGTGGATGAAGACTGGTGGATGGGTACCAACTCCAAGGGCGAAAGTGGTTTGTTTCCGAGCAACTACGT
CGAGCTTATCGATGACGAGGGCGAGTCAGCAGGTGCGAGAGCACCGGCGCCTGAGCTTGAGACGAGGGCGGCAAG
TCACACTGCGGATGCCGGCGATACAGCAACTGCCATGTACGATTACGAAGCCGCCGAGGATAACGGTAATTTTGC
ACCTTTCTGTATGCTTTTTGTATCTCACAACTGACTTTTGGACGGTTTATAGAGCTCAGCTTTCCAGAAGATGCA
GTCATTACCAATCTTGAATTCCCCGACGAAGACTGGTGGTTCGGGCACTATGATGGGCAGTCTGGCCTGTTCCCT
GCCAATTATGTGCAGCTCAAACAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail