Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2405
Gene name
LocationContig_175:14155..16657
Strand+
Gene length (bp)2502
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14604 SH3_9 Variant SH3 domain 9.9E-11 649 696
PF14604 SH3_9 Variant SH3 domain 6.9E-16 731 779
PF00018 SH3_1 SH3 domain 2.3E-10 649 692
PF00018 SH3_1 SH3 domain 3.0E-13 731 775
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 9.7E-16 57 150
PF07653 SH3_2 Variant SH3 domain 3.4E-05 650 697
PF07653 SH3_2 Variant SH3 domain 1.9E-05 731 779

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 3 166 3.0E-32
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 3 165 2.0E-31
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 5 192 6.0E-31
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 3 179 7.0E-31
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 3 179 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 3 166 3.0E-32
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 3 165 2.0E-31
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 5 192 6.0E-31
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 3 179 7.0E-31
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 3 179 7.0E-26
sp|Q62418|DBNL_MOUSE Drebrin-like protein OS=Mus musculus GN=Dbnl PE=1 SV=2 3 192 1.0E-25
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 4 166 1.0E-23
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 59 157 1.0E-17
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 638 779 2.0E-17
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 63 422 2.0E-16
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 638 780 1.0E-15
sp|Q557J6|DBNL_DICDI Drebrin-like protein OS=Dictyostelium discoideum GN=abpE-1 PE=2 SV=1 1 192 5.0E-15
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 62 432 5.0E-15
sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens GN=CTTN PE=1 SV=2 703 782 7.0E-14
sp|Q66HL2|SRC8_RAT Src substrate cortactin OS=Rattus norvegicus GN=Cttn PE=1 SV=1 721 782 8.0E-14
sp|Q60598|SRC8_MOUSE Src substrate cortactin OS=Mus musculus GN=Cttn PE=1 SV=2 721 782 1.0E-13
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 729 780 3.0E-13
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 729 780 3.0E-13
sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 646 779 3.0E-13
sp|Q01406|SRC8_CHICK Src substrate protein p85 OS=Gallus gallus GN=CTTN1 PE=1 SV=1 703 782 4.0E-13
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 642 781 4.0E-13
sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 645 779 4.0E-13
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 642 781 1.0E-12
sp|F1LRS8|CD2AP_RAT CD2-associated protein OS=Rattus norvegicus GN=Cd2ap PE=1 SV=2 646 779 1.0E-12
sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 645 779 1.0E-12
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 658 780 2.0E-12
sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 645 779 2.0E-12
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 642 781 2.0E-12
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 649 782 3.0E-12
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 677 780 3.0E-12
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 677 780 4.0E-12
sp|Q16643|DREB_HUMAN Drebrin OS=Homo sapiens GN=DBN1 PE=1 SV=4 1 153 4.0E-12
sp|Q07266|DREB_RAT Drebrin OS=Rattus norvegicus GN=Dbn1 PE=1 SV=3 1 153 4.0E-12
sp|Q9QXS6|DREB_MOUSE Drebrin OS=Mus musculus GN=Dbn1 PE=1 SV=4 1 153 6.0E-12
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 642 779 8.0E-12
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 645 697 1.0E-11
sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens GN=CD2AP PE=1 SV=1 646 779 2.0E-11
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 658 780 3.0E-11
sp|Q9P7E8|APP1_SCHPO Protein app1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=app1 PE=2 SV=1 637 698 4.0E-11
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 645 782 5.0E-11
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 642 779 6.0E-11
sp|Q99M51|NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus GN=Nck1 PE=1 SV=1 645 782 8.0E-11
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 658 780 1.0E-10
sp|P16333|NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens GN=NCK1 PE=1 SV=1 645 782 2.0E-10
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 658 780 2.0E-10
sp|Q69ZI1|SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus GN=Sh3rf1 PE=1 SV=2 649 781 2.0E-10
sp|P18302|DREB_CHICK Drebrin OS=Gallus gallus GN=DBN1 PE=2 SV=4 1 153 2.0E-10
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 726 780 3.0E-10
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 726 780 3.0E-10
sp|Q62418|DBNL_MOUSE Drebrin-like protein OS=Mus musculus GN=Dbnl PE=1 SV=2 726 780 3.0E-10
sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 649 781 3.0E-10
sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 649 780 3.0E-10
sp|O43639|NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens GN=NCK2 PE=1 SV=2 645 778 3.0E-10
sp|A7E8B6|SLA1_SCLS1 Actin cytoskeleton-regulatory complex protein sla1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sla1 PE=3 SV=2 649 782 3.0E-10
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 724 780 4.0E-10
sp|Q5HYK7|SH319_HUMAN SH3 domain-containing protein 19 OS=Homo sapiens GN=SH3D19 PE=1 SV=2 642 779 4.0E-10
sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 649 781 4.0E-10
sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 649 781 5.0E-10
sp|P14317|HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens GN=HCLS1 PE=1 SV=3 728 780 5.0E-10
sp|O60504|VINEX_HUMAN Vinexin OS=Homo sapiens GN=SORBS3 PE=1 SV=2 635 782 5.0E-10
sp|Q9R1Z8|VINEX_MOUSE Vinexin OS=Mus musculus GN=Sorbs3 PE=1 SV=1 637 782 5.0E-10
sp|Q99M51|NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus GN=Nck1 PE=1 SV=1 648 778 6.0E-10
sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 649 780 6.0E-10
sp|P34258|YKA7_CAEEL Uncharacterized protein B0303.7 OS=Caenorhabditis elegans GN=B0303.7 PE=1 SV=5 646 778 6.0E-10
sp|P16333|NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens GN=NCK1 PE=1 SV=1 648 778 8.0E-10
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 726 780 1.0E-09
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 645 697 1.0E-09
sp|O55033|NCK2_MOUSE Cytoplasmic protein NCK2 OS=Mus musculus GN=Nck2 PE=1 SV=1 645 778 1.0E-09
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 724 780 2.0E-09
sp|Q9JHL4|DBNL_RAT Drebrin-like protein OS=Rattus norvegicus GN=Dbnl PE=1 SV=1 593 699 2.0E-09
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 642 699 2.0E-09
sp|O43639|NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens GN=NCK2 PE=1 SV=2 645 778 2.0E-09
sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 649 781 2.0E-09
sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=1 SV=1 649 780 2.0E-09
sp|Q75JD4|Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum GN=DDB_G0271676 PE=3 SV=1 649 780 2.0E-09
sp|Q62418|DBNL_MOUSE Drebrin-like protein OS=Mus musculus GN=Dbnl PE=1 SV=2 636 699 3.0E-09
sp|Q60598|SRC8_MOUSE Src substrate cortactin OS=Mus musculus GN=Cttn PE=1 SV=2 642 697 3.0E-09
sp|Q9UJU6|DBNL_HUMAN Drebrin-like protein OS=Homo sapiens GN=DBNL PE=1 SV=1 642 699 4.0E-09
sp|Q14247|SRC8_HUMAN Src substrate cortactin OS=Homo sapiens GN=CTTN PE=1 SV=2 642 697 4.0E-09
sp|Q6TXD4|DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus GN=Dnmbp PE=1 SV=2 656 780 4.0E-09
sp|Q66HL2|SRC8_RAT Src substrate cortactin OS=Rattus norvegicus GN=Cttn PE=1 SV=1 642 697 5.0E-09
sp|Q8TEJ3|SH3R3_HUMAN SH3 domain-containing RING finger protein 3 OS=Homo sapiens GN=SH3RF3 PE=1 SV=2 649 780 6.0E-09
sp|P39743|RV167_YEAST Reduced viability upon starvation protein 167 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RVS167 PE=1 SV=1 727 782 6.0E-09
sp|Q7ZXQ9|DBNLA_XENLA Drebrin-like protein A OS=Xenopus laevis GN=dbnl-a PE=2 SV=1 639 699 7.0E-09
sp|P49710|HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus GN=Hcls1 PE=1 SV=2 732 780 7.0E-09
sp|O94868|FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens GN=FCHSD2 PE=1 SV=3 647 779 7.0E-09
sp|Q62417|SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus GN=Sorbs1 PE=1 SV=2 608 780 8.0E-09
sp|Q9VU84|DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster GN=Abp1 PE=1 SV=1 724 780 1.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 642 780 1.0E-08
sp|Q6PFY1|FCSD1_MOUSE F-BAR and double SH3 domains protein 1 OS=Mus musculus GN=Fchsd1 PE=2 SV=1 645 779 1.0E-08
sp|Q3USJ8|FCSD2_MOUSE F-BAR and double SH3 domains protein 2 OS=Mus musculus GN=Fchsd2 PE=1 SV=2 647 779 1.0E-08
sp|A6H7G2|DBNL_BOVIN Drebrin-like protein OS=Bos taurus GN=DBNL PE=2 SV=1 642 699 2.0E-08
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 655 779 2.0E-08
sp|Q6GM14|DBNLB_XENLA Drebrin-like protein B OS=Xenopus laevis GN=dbnl-b PE=2 SV=1 638 699 3.0E-08
sp|Q9BX66|SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens GN=SORBS1 PE=1 SV=3 608 780 3.0E-08
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 656 780 3.0E-08
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 642 780 4.0E-08
sp|Q59LF3|RV167_CANAL Regulator of cytoskeleton and endocytosis RVS167 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RVS167 PE=3 SV=1 728 780 4.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 642 780 5.0E-08
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 682 778 5.0E-08
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 649 712 7.0E-08
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 684 778 1.0E-07
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 635 780 2.0E-07
sp|O88811|STAM2_MOUSE Signal transducing adapter molecule 2 OS=Mus musculus GN=Stam2 PE=1 SV=1 731 778 2.0E-07
sp|Q86WN1|FCSD1_HUMAN F-BAR and double SH3 domains protein 1 OS=Homo sapiens GN=FCHSD1 PE=1 SV=1 645 779 2.0E-07
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 655 779 3.0E-07
sp|O55033|NCK2_MOUSE Cytoplasmic protein NCK2 OS=Mus musculus GN=Nck2 PE=1 SV=1 645 778 3.0E-07
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 731 778 3.0E-07
sp|Q99961|SH3G1_HUMAN Endophilin-A2 OS=Homo sapiens GN=SH3GL1 PE=1 SV=1 728 780 3.0E-07
sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 728 780 3.0E-07
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 726 780 4.0E-07
sp|O93436|STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus GN=STAM2 PE=1 SV=1 637 695 4.0E-07
sp|Q2KJA1|SH3G1_BOVIN Endophilin-A2 OS=Bos taurus GN=SH3GL1 PE=2 SV=1 728 780 4.0E-07
sp|O94875|SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens GN=SORBS2 PE=1 SV=3 645 779 8.0E-07
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 731 778 8.0E-07
sp|P10569|MYSC_ACACA Myosin IC heavy chain OS=Acanthamoeba castellanii GN=MIC PE=1 SV=1 729 780 8.0E-07
sp|O75886|STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens GN=STAM2 PE=1 SV=1 731 778 9.0E-07
sp|Q3UTJ2|SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus GN=Sorbs2 PE=1 SV=2 649 780 1.0E-06
sp|P14317|HCLS1_HUMAN Hematopoietic lineage cell-specific protein OS=Homo sapiens GN=HCLS1 PE=1 SV=3 644 699 2.0E-06
sp|P34258|YKA7_CAEEL Uncharacterized protein B0303.7 OS=Caenorhabditis elegans GN=B0303.7 PE=1 SV=5 642 778 2.0E-06
sp|Q92783|STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens GN=STAM PE=1 SV=3 634 695 2.0E-06
sp|P70297|STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus GN=Stam PE=1 SV=3 634 695 2.0E-06
sp|Q5XHY7|STAM2_RAT Signal transducing adapter molecule 2 OS=Rattus norvegicus GN=Stam2 PE=2 SV=1 649 695 2.0E-06
sp|Q62419|SH3G1_MOUSE Endophilin-A2 OS=Mus musculus GN=Sh3gl1 PE=1 SV=1 728 780 2.0E-06
sp|Q2KJB5|NOSTN_BOVIN Nostrin OS=Bos taurus GN=NOSTRIN PE=1 SV=1 695 779 2.0E-06
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 727 780 2.0E-06
sp|O35413|SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus GN=Sorbs2 PE=1 SV=2 649 780 2.0E-06
sp|Q99MZ8|LASP1_RAT LIM and SH3 domain protein 1 OS=Rattus norvegicus GN=Lasp1 PE=1 SV=1 641 698 2.0E-06
sp|Q61792|LASP1_MOUSE LIM and SH3 domain protein 1 OS=Mus musculus GN=Lasp1 PE=1 SV=1 641 698 2.0E-06
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 731 778 2.0E-06
sp|Q3B7M5|LASP1_BOVIN LIM and SH3 domain protein 1 OS=Bos taurus GN=LASP1 PE=2 SV=1 641 698 2.0E-06
sp|O94875|SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens GN=SORBS2 PE=1 SV=3 649 780 3.0E-06
sp|Q4P5J4|HSE1_USTMA Class E vacuolar protein-sorting machinery protein HSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HSE1 PE=3 SV=1 649 741 3.0E-06
sp|Q8N157|AHI1_HUMAN Jouberin OS=Homo sapiens GN=AHI1 PE=1 SV=1 714 778 3.0E-06
sp|O74749|HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hse1 PE=3 SV=1 715 779 3.0E-06
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 649 700 3.0E-06
sp|Q14847|LASP1_HUMAN LIM and SH3 domain protein 1 OS=Homo sapiens GN=LASP1 PE=1 SV=2 641 698 3.0E-06
sp|Q5R5W0|LASP1_PONAB LIM and SH3 domain protein 1 OS=Pongo abelii GN=LASP1 PE=2 SV=1 641 698 3.0E-06
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 731 779 4.0E-06
sp|A8MVU1|NCF1C_HUMAN Putative neutrophil cytosol factor 1C OS=Homo sapiens GN=NCF1C PE=5 SV=1 650 779 4.0E-06
sp|O75791|GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens GN=GRAP2 PE=1 SV=1 729 778 4.0E-06
sp|P34121|COAA_DICDI Coactosin OS=Dictyostelium discoideum GN=coaA PE=1 SV=1 8 166 4.0E-06
sp|P20929|NEBU_HUMAN Nebulin OS=Homo sapiens GN=NEB PE=1 SV=5 720 779 4.0E-06
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 642 779 4.0E-06
sp|P49710|HCLS1_MOUSE Hematopoietic lineage cell-specific protein OS=Mus musculus GN=Hcls1 PE=1 SV=2 649 698 5.0E-06
sp|Q5I0D6|NOSTN_RAT Nostrin OS=Rattus norvegicus GN=Nostrin PE=1 SV=1 697 779 6.0E-06
sp|A2AAY5|SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus GN=Sh3pxd2b PE=1 SV=1 646 779 6.0E-06
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 731 779 6.0E-06
sp|O77506|LASP1_RABIT LIM and SH3 domain protein 1 OS=Oryctolagus cuniculus GN=LASP1 PE=1 SV=1 641 698 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0005515 protein binding Yes
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2405
MASLNLSINGPSIKSSYNGVVNDALPASDSPTRAQWALFTVQAPLVNAFQDSGAKESILKVQSTGDGELADLIED
FSEGRVQFAFVKVKDPNTALPKCILIAWCGGGVPERTKGYFTSHTAAVAKVLHGYHVQITARSDADLEPESIMKK
VADASGAKYSAASSSSGAMPAAGRPPVKSKPVFTPTMSTTGRSVNPLVAARSRRDTNVDQDGWGDDAPPVTRTQL
ERVEPAYRPIKVNMNDLASQKAESSRLDGSTRQQDNGPNTVVKGAYQPVGKVDIAAIRAAAKQEDYRPSPVKGAY
EPVGKVDIAAIRARAQKPTEEADVDAPAPTPLADRATAFSQPSQSERIMSLPKPKVANKFGGASFAGTKAPVPGG
LGFGTPSASLPAPAATTSRTFADQGGKTPAQLWAEKKARERGASASSTGGTPSATSPIAPQPSGGWKSGYSGKSW
APVQAPGYGRSAPEDVVRQDTGDATHGTTGEGQDMSAEGVAVLKDRFKQAAPPSPQEASPASRMSPQEPQREFQT
SSTSISRPSGGFALPGLPSRPPPPTEEEQEEEYQHSEEEAASPIRVAVPVAREADAKEASTPLTEAPTPPSGDDV
PREKHLPDEEETDYSARRAAAAVAEQNLPVHQETAYQAEQGGKSALIQYDYDKAEDNEIDLIEGELVTNIDMVDE
DWWMGTNSKGESGLFPSNYVELIDDEGESAGARAPAPELETRAASHTADAGDTATAMYDYEAAEDNELSFPEDAV
ITNLEFPDEDWWFGHYDGQSGLFPANYVQLKQ*
Coding >OphauB2|2405
ATGGCCTCATTGAACTTGTCCATCAATGGGCCTTCGATAAAGAGCAGCTACAATGGTGTTGTCAACGACGCTTTG
CCCGCCTCCGACTCTCCCACCCGCGCTCAATGGGCCCTCTTTACGGTCCAGGCTCCGCTAGTGAATGCTTTTCAG
GACAGCGGCGCCAAAGAGAGCATACTCAAGGTCCAAAGCACAGGCGACGGTGAGCTTGCCGACCTAATCGAAGAC
TTCAGCGAGGGCCGAGTGCAGTTTGCCTTTGTCAAGGTCAAGGACCCAAATACCGCGCTGCCCAAATGCATCCTC
ATTGCCTGGTGCGGTGGCGGCGTGCCTGAGCGAACCAAGGGCTACTTTACCAGTCACACGGCAGCTGTTGCCAAG
GTCTTGCACGGATATCACGTTCAAATCACGGCTCGCTCCGATGCTGATCTTGAACCCGAATCCATCATGAAAAAG
GTGGCAGATGCATCTGGTGCCAAGTACTCAGCTGCTTCCTCGAGCAGCGGCGCTATGCCTGCTGCGGGACGGCCT
CCTGTTAAGTCAAAGCCCGTCTTCACTCCTACAATGTCTACTACCGGTCGCTCCGTGAATCCTCTAGTGGCAGCA
CGGTCTAGGAGAGACACTAATGTGGACCAAGATGGCTGGGGAGACGATGCTCCTCCAGTCACACGAACGCAGCTC
GAAAGAGTTGAGCCGGCCTATAGACCCATCAAAGTCAACATGAATGATCTCGCCAGCCAAAAAGCGGAGTCGTCG
CGCTTGGATGGCAGCACTCGTCAACAGGACAATGGACCGAACACCGTCGTCAAAGGAGCATATCAGCCTGTAGGC
AAAGTGGATATTGCTGCCATAAGAGCTGCCGCCAAGCAAGAAGACTATCGACCGTCGCCAGTCAAGGGAGCTTAC
GAGCCAGTGGGCAAAGTGGACATTGCTGCAATTCGTGCGAGAGCTCAGAAGCCTACTGAAGAAGCCGACGTTGAC
GCTCCTGCGCCCACCCCGCTGGCCGACAGGGCTACTGCCTTTTCCCAGCCCAGCCAGTCGGAGCGCATCATGTCC
TTGCCCAAGCCAAAGGTGGCCAACAAGTTTGGTGGAGCCAGCTTTGCTGGCACCAAGGCACCCGTACCTGGCGGC
CTTGGATTCGGCACTCCAAGTGCATCTTTGCCGGCACCCGCGGCGACAACCAGCCGCACCTTTGCTGACCAGGGG
GGGAAGACACCAGCCCAATTATGGGCCGAGAAGAAGGCGAGAGAAAGAGGAGCATCTGCTAGCAGCACTGGCGGC
ACACCGTCAGCCACGAGCCCTATTGCTCCTCAGCCAAGCGGTGGCTGGAAGAGCGGCTATTCTGGCAAAAGCTGG
GCCCCAGTGCAGGCTCCGGGCTATGGTCGCAGTGCGCCCGAAGATGTGGTTCGGCAGGATACAGGAGATGCTACC
CATGGCACTACTGGAGAGGGTCAAGACATGTCGGCTGAAGGCGTGGCTGTCCTCAAAGATCGCTTCAAGCAAGCA
GCTCCACCAAGTCCACAAGAAGCCTCTCCAGCGTCGAGGATGTCGCCGCAAGAGCCTCAACGTGAGTTCCAGACC
TCGTCAACCAGTATTTCGCGGCCCTCTGGCGGATTCGCGCTCCCAGGACTCCCCTCCCGTCCACCACCTCCCACC
GAGGAAGAGCAGGAAGAGGAATATCAACATAGCGAAGAAGAGGCAGCCTCCCCGATACGAGTAGCTGTTCCGGTT
GCGCGTGAAGCAGACGCCAAGGAAGCGAGCACGCCCCTGACAGAAGCTCCCACGCCACCCAGCGGTGATGACGTA
CCAAGGGAAAAGCATCTTCCAGACGAGGAAGAGACAGACTATAGTGCTCGCAGAGCCGCTGCTGCTGTGGCCGAG
CAGAACCTACCAGTGCATCAGGAGACTGCATATCAGGCTGAGCAGGGCGGCAAATCTGCGCTTATTCAGTACGAT
TATGACAAGGCTGAGGACAATGAAATTGACCTCATCGAGGGCGAGCTTGTGACCAATATTGACATGGTGGATGAA
GACTGGTGGATGGGTACCAACTCCAAGGGCGAAAGTGGTTTGTTTCCGAGCAACTACGTCGAGCTTATCGATGAC
GAGGGCGAGTCAGCAGGTGCGAGAGCACCGGCGCCTGAGCTTGAGACGAGGGCGGCAAGTCACACTGCGGATGCC
GGCGATACAGCAACTGCCATGTACGATTACGAAGCCGCCGAGGATAACGAGCTCAGCTTTCCAGAAGATGCAGTC
ATTACCAATCTTGAATTCCCCGACGAAGACTGGTGGTTCGGGCACTATGATGGGCAGTCTGGCCTGTTCCCTGCC
AATTATGTGCAGCTCAAACAGTGA
Transcript >OphauB2|2405
ATGGCCTCATTGAACTTGTCCATCAATGGGCCTTCGATAAAGAGCAGCTACAATGGTGTTGTCAACGACGCTTTG
CCCGCCTCCGACTCTCCCACCCGCGCTCAATGGGCCCTCTTTACGGTCCAGGCTCCGCTAGTGAATGCTTTTCAG
GACAGCGGCGCCAAAGAGAGCATACTCAAGGTCCAAAGCACAGGCGACGGTGAGCTTGCCGACCTAATCGAAGAC
TTCAGCGAGGGCCGAGTGCAGTTTGCCTTTGTCAAGGTCAAGGACCCAAATACCGCGCTGCCCAAATGCATCCTC
ATTGCCTGGTGCGGTGGCGGCGTGCCTGAGCGAACCAAGGGCTACTTTACCAGTCACACGGCAGCTGTTGCCAAG
GTCTTGCACGGATATCACGTTCAAATCACGGCTCGCTCCGATGCTGATCTTGAACCCGAATCCATCATGAAAAAG
GTGGCAGATGCATCTGGTGCCAAGTACTCAGCTGCTTCCTCGAGCAGCGGCGCTATGCCTGCTGCGGGACGGCCT
CCTGTTAAGTCAAAGCCCGTCTTCACTCCTACAATGTCTACTACCGGTCGCTCCGTGAATCCTCTAGTGGCAGCA
CGGTCTAGGAGAGACACTAATGTGGACCAAGATGGCTGGGGAGACGATGCTCCTCCAGTCACACGAACGCAGCTC
GAAAGAGTTGAGCCGGCCTATAGACCCATCAAAGTCAACATGAATGATCTCGCCAGCCAAAAAGCGGAGTCGTCG
CGCTTGGATGGCAGCACTCGTCAACAGGACAATGGACCGAACACCGTCGTCAAAGGAGCATATCAGCCTGTAGGC
AAAGTGGATATTGCTGCCATAAGAGCTGCCGCCAAGCAAGAAGACTATCGACCGTCGCCAGTCAAGGGAGCTTAC
GAGCCAGTGGGCAAAGTGGACATTGCTGCAATTCGTGCGAGAGCTCAGAAGCCTACTGAAGAAGCCGACGTTGAC
GCTCCTGCGCCCACCCCGCTGGCCGACAGGGCTACTGCCTTTTCCCAGCCCAGCCAGTCGGAGCGCATCATGTCC
TTGCCCAAGCCAAAGGTGGCCAACAAGTTTGGTGGAGCCAGCTTTGCTGGCACCAAGGCACCCGTACCTGGCGGC
CTTGGATTCGGCACTCCAAGTGCATCTTTGCCGGCACCCGCGGCGACAACCAGCCGCACCTTTGCTGACCAGGGG
GGGAAGACACCAGCCCAATTATGGGCCGAGAAGAAGGCGAGAGAAAGAGGAGCATCTGCTAGCAGCACTGGCGGC
ACACCGTCAGCCACGAGCCCTATTGCTCCTCAGCCAAGCGGTGGCTGGAAGAGCGGCTATTCTGGCAAAAGCTGG
GCCCCAGTGCAGGCTCCGGGCTATGGTCGCAGTGCGCCCGAAGATGTGGTTCGGCAGGATACAGGAGATGCTACC
CATGGCACTACTGGAGAGGGTCAAGACATGTCGGCTGAAGGCGTGGCTGTCCTCAAAGATCGCTTCAAGCAAGCA
GCTCCACCAAGTCCACAAGAAGCCTCTCCAGCGTCGAGGATGTCGCCGCAAGAGCCTCAACGTGAGTTCCAGACC
TCGTCAACCAGTATTTCGCGGCCCTCTGGCGGATTCGCGCTCCCAGGACTCCCCTCCCGTCCACCACCTCCCACC
GAGGAAGAGCAGGAAGAGGAATATCAACATAGCGAAGAAGAGGCAGCCTCCCCGATACGAGTAGCTGTTCCGGTT
GCGCGTGAAGCAGACGCCAAGGAAGCGAGCACGCCCCTGACAGAAGCTCCCACGCCACCCAGCGGTGATGACGTA
CCAAGGGAAAAGCATCTTCCAGACGAGGAAGAGACAGACTATAGTGCTCGCAGAGCCGCTGCTGCTGTGGCCGAG
CAGAACCTACCAGTGCATCAGGAGACTGCATATCAGGCTGAGCAGGGCGGCAAATCTGCGCTTATTCAGTACGAT
TATGACAAGGCTGAGGACAATGAAATTGACCTCATCGAGGGCGAGCTTGTGACCAATATTGACATGGTGGATGAA
GACTGGTGGATGGGTACCAACTCCAAGGGCGAAAGTGGTTTGTTTCCGAGCAACTACGTCGAGCTTATCGATGAC
GAGGGCGAGTCAGCAGGTGCGAGAGCACCGGCGCCTGAGCTTGAGACGAGGGCGGCAAGTCACACTGCGGATGCC
GGCGATACAGCAACTGCCATGTACGATTACGAAGCCGCCGAGGATAACGAGCTCAGCTTTCCAGAAGATGCAGTC
ATTACCAATCTTGAATTCCCCGACGAAGACTGGTGGTTCGGGCACTATGATGGGCAGTCTGGCCTGTTCCCTGCC
AATTATGTGCAGCTCAAACAGTGA
Gene >OphauB2|2405
ATGGCCTCATTGAACTTGTCCATCAATGGGCCTTCGATAAAGAGCAGCTACAATGGTGTTGTCAACGACGCTTTG
CCCGCCTCCGACTCTCCCACCCGCGCTCAATGGGCCCTCTTTACGGTCCAGGCTCCGCTAGTGAATGCTTTTCAG
GACAGCGGCGCCAAAGAGAGCATACTCAAGGTCCAAAGCACAGGCGGTAATGCTTGTTCCCCTCCTCACCAGTCC
ACCCCTGTGCAGGATTTCAAGAGGCTTGGCGCATTGCCTCGAGATACTAACCTCTTCTGCAGACGGTGAGCTTGC
CGACCTAATCGAAGACTTCAGCGAGGGCCGAGTGCAGTTTGCCTTTGTCAAGGTCAAGGACCCAAATACCGCGCT
GCCCAAATGCATCCTCATTGCCTGGTGCGGTGGCGGCGTGCCTGAGCGAACCAAGGGCTACTTTACCAGTCACAC
GGCAGCTGTTGCCAAGGTCTTGCACGGATATCACGTTCAAATCACGGCTCGCTCCGATGCTGATCTTGAACCCGA
ATCCATCATGAAAAAGGTGGCAGATGCATCTGGTGCCAAGTACTCAGCTGCTTCCTCGAGCAGCGGCGCTATGCC
TGCTGCGGGACGGCCTCCTGTTAAGTCAAAGCCCGTCTTCACTCCTACAATGTCTACTACCGGTCGCTCCGTGAA
TCCTCTAGTGGCAGCACGGTCTAGGAGAGACACTAATGTGGACCAAGATGGCTGGGGAGACGATGCTCCTCCAGT
CACACGAACGCAGCTCGAAAGAGTTGAGCCGGCCTATAGACCCATCAAAGTCAACATGAATGATCTCGCCAGCCA
AAAAGCGGAGTCGTCGCGCTTGGATGGCAGCACTCGTCAACAGGACAATGGACCGAACACCGTCGTCAAAGGAGC
ATATCAGCCTGTAGGCAAAGTGGATATTGCTGCCATAAGAGCTGCCGCCAAGCAAGAAGACTATCGACCGTCGCC
AGTCAAGGGAGCTTACGAGCCAGTGGGCAAAGTGGACATTGCTGCAATTCGTGCGAGAGCTCAGAAGCCTACTGA
AGAAGCCGACGTTGACGCTCCTGCGCCCACCCCGCTGGCCGACAGGGCTACTGCCTTTTCCCAGCCCAGCCAGTC
GGAGCGCATCATGTCCTTGCCCAAGCCAAAGGTGGCCAACAAGTTTGGTGGAGCCAGCTTTGCTGGCACCAAGGC
ACCCGTACCTGGCGGCCTTGGATTCGGCACTCCAAGTGCATCTTTGCCGGCACCCGCGGCGACAACCAGCCGCAC
CTTTGCTGACCAGGGGGGGAAGACACCAGCCCAATTATGGGCCGAGAAGAAGGCGAGAGAAAGAGGAGCATCTGC
TAGCAGCACTGGCGGCACACCGTCAGCCACGAGCCCTATTGCTCCTCAGCCAAGCGGTGGCTGGAAGAGCGGCTA
TTCTGGCAAAAGCTGGGCCCCAGTGCAGGCTCCGGGCTATGGTCGCAGTGCGCCCGAAGATGTGGTTCGGCAGGA
TACAGGAGATGCTACCCATGGCACTACTGGAGAGGGTCAAGACATGTCGGCTGAAGGCGTGGCTGTCCTCAAAGA
TCGCTTCAAGCAAGCAGCTCCACCAAGTCCACAAGAAGCCTCTCCAGCGTCGAGGATGTCGCCGCAAGAGCCTCA
ACGTGAGTTCCAGACCTCGTCAACCAGTATTTCGCGGCCCTCTGGCGGATTCGCGCTCCCAGGACTCCCCTCCCG
TCCACCACCTCCCACCGAGGAAGAGCAGGAAGAGGAATATCAACATAGCGAAGAAGAGGCAGCCTCCCCGATACG
AGTAGCTGTTCCGGTTGCGCGTGAAGCAGACGCCAAGGAAGCGAGCACGCCCCTGACAGAAGCTCCCACGCCACC
CAGCGGTGATGACGTACCAAGGGAAAAGCATCTTCCAGACGAGGAAGAGACAGACTATAGTGCTCGCAGAGCCGC
TGCTGCTGTGGCCGAGCAGAACCTACCAGTGCATCAGGAGACTGCATATCAGGCTGAGCAGGGCGGCAAATCTGC
GCTTATTCAGTACGATTATGACAAGGCTGAGGACAATGAAATTGACCTCATCGAGGGCGAGCTTGTGACCAATAT
TGACATGGTGGATGAAGACTGGTGGATGGGTACCAACTCCAAGGGCGAAAGTGGTTTGTTTCCGAGCAACTACGT
CGAGCTTATCGATGACGAGGGCGAGTCAGCAGGTGCGAGAGCACCGGCGCCTGAGCTTGAGACGAGGGCGGCAAG
TCACACTGCGGATGCCGGCGATACAGCAACTGCCATGTACGATTACGAAGCCGCCGAGGATAACGGTAATTTTGC
ACCTTTCTGTATGCTTTTTGTATCTCACAACTGACTTTTGGACGGTTTATAGAGCTCAGCTTTCCAGAAGATGCA
GTCATTACCAATCTTGAATTCCCCGACGAAGACTGGTGGTTCGGGCACTATGATGGGCAGTCTGGCCTGTTCCCT
GCCAATTATGTGCAGCTCAAACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail