Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2404
Gene name
LocationContig_175:12516..13376
Strand-
Gene length (bp)860
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 5.8E-18 173 237
PF00085 Thioredoxin Thioredoxin 1.6E-12 15 107

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32642|GLRX4_YEAST Monothiol glutaredoxin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX4 PE=1 SV=1 8 255 2.0E-63
sp|O74790|GLRX4_SCHPO Monothiol glutaredoxin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx4 PE=1 SV=1 10 249 2.0E-60
sp|Q03835|GLRX3_YEAST Monothiol glutaredoxin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX3 PE=1 SV=2 9 255 2.0E-58
sp|Q5XJ54|GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio GN=glrx3 PE=2 SV=1 6 249 3.0E-57
sp|O76003|GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens GN=GLRX3 PE=1 SV=2 14 245 3.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32642|GLRX4_YEAST Monothiol glutaredoxin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX4 PE=1 SV=1 8 255 2.0E-63
sp|O74790|GLRX4_SCHPO Monothiol glutaredoxin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx4 PE=1 SV=1 10 249 2.0E-60
sp|Q03835|GLRX3_YEAST Monothiol glutaredoxin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX3 PE=1 SV=2 9 255 2.0E-58
sp|Q5XJ54|GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio GN=glrx3 PE=2 SV=1 6 249 3.0E-57
sp|O76003|GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens GN=GLRX3 PE=1 SV=2 14 245 3.0E-56
sp|Q28ID3|GLRX3_XENTR Glutaredoxin-3 OS=Xenopus tropicalis GN=glrx3 PE=2 SV=2 6 245 2.0E-55
sp|Q9JLZ1|GLRX3_RAT Glutaredoxin-3 OS=Rattus norvegicus GN=Glrx3 PE=1 SV=2 14 245 1.0E-53
sp|Q9CQM9|GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus GN=Glrx3 PE=1 SV=1 14 245 3.0E-53
sp|Q58DA7|GLRX3_BOVIN Glutaredoxin-3 OS=Bos taurus GN=GLRX3 PE=2 SV=1 17 245 9.0E-52
sp|Q86H62|GLRX3_DICDI Glutaredoxin-3 homolog OS=Dictyostelium discoideum GN=glrx3 PE=3 SV=1 12 245 2.0E-47
sp|Q0IWL9|GRS11_ORYSJ Monothiol glutaredoxin-S11 OS=Oryza sativa subsp. japonica GN=GRXS11 PE=2 SV=2 33 259 1.0E-45
sp|Q9ZPH2|GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana GN=GRXS17 PE=1 SV=1 7 260 4.0E-45
sp|Q28ID3|GLRX3_XENTR Glutaredoxin-3 OS=Xenopus tropicalis GN=glrx3 PE=2 SV=2 158 249 2.0E-29
sp|Q0IWL9|GRS11_ORYSJ Monothiol glutaredoxin-S11 OS=Oryza sativa subsp. japonica GN=GRXS11 PE=2 SV=2 153 245 2.0E-29
sp|Q5XJ54|GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio GN=glrx3 PE=2 SV=1 160 249 7.0E-29
sp|Q9ZPH2|GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana GN=GRXS17 PE=1 SV=1 153 250 1.0E-27
sp|Q58DA7|GLRX3_BOVIN Glutaredoxin-3 OS=Bos taurus GN=GLRX3 PE=2 SV=1 160 245 3.0E-27
sp|Q9ZPH2|GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana GN=GRXS17 PE=1 SV=1 158 245 3.0E-27
sp|O76003|GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens GN=GLRX3 PE=1 SV=2 160 245 7.0E-27
sp|Q9JLZ1|GLRX3_RAT Glutaredoxin-3 OS=Rattus norvegicus GN=Glrx3 PE=1 SV=2 160 245 8.0E-26
sp|Q9CQM9|GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus GN=Glrx3 PE=1 SV=1 160 245 8.0E-26
sp|Q0IWL9|GRS11_ORYSJ Monothiol glutaredoxin-S11 OS=Oryza sativa subsp. japonica GN=GRXS11 PE=2 SV=2 135 245 1.0E-25
sp|Q02784|GLRX5_YEAST Monothiol glutaredoxin-5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX5 PE=1 SV=1 159 243 2.0E-24
sp|P73056|YC64L_SYNY3 Uncharacterized monothiol glutaredoxin ycf64-like OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1846 PE=3 SV=1 163 245 4.0E-24
sp|Q6PBM1|GLRX5_DANRE Glutaredoxin-related protein 5, mitochondrial OS=Danio rerio GN=glrx5 PE=2 SV=1 162 243 5.0E-24
sp|Q6YFE4|GLRX5_LACKL Monothiol glutaredoxin-5, mitochondrial OS=Lachancea kluyveri GN=GRX5 PE=3 SV=1 168 243 5.0E-24
sp|Q86SX6|GLRX5_HUMAN Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens GN=GLRX5 PE=1 SV=2 162 252 6.0E-24
sp|Q80Y14|GLRX5_MOUSE Glutaredoxin-related protein 5, mitochondrial OS=Mus musculus GN=Glrx5 PE=1 SV=2 162 252 7.0E-24
sp|P57284|GLRX4_BUCAI Glutaredoxin-4 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=grxD PE=3 SV=1 160 249 4.0E-23
sp|Q92GH5|GLRX2_RICCN Probable monothiol glutaredoxin-2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=grxC2 PE=3 SV=2 161 249 8.0E-23
sp|Q68W05|GLRX2_RICTY Probable monothiol glutaredoxin-2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=grxC2 PE=3 SV=1 162 245 9.0E-23
sp|Q9HDW8|GLRX5_SCHPO Monothiol glutaredoxin-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grx5 PE=1 SV=1 164 243 1.0E-22
sp|Q851Y7|GRXS7_ORYSJ Monothiol glutaredoxin-S7, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXS7 PE=2 SV=1 164 250 1.0E-22
sp|Q89AR8|GLRX4_BUCBP Glutaredoxin-4 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=grxD PE=3 SV=1 158 249 2.0E-22
sp|Q84Y95|GRS14_ARATH Monothiol glutaredoxin-S14, chloroplastic OS=Arabidopsis thaliana GN=GRXS14 PE=1 SV=2 147 249 7.0E-22
sp|Q8K9V6|GLRX4_BUCAP Glutaredoxin-4 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=grxD PE=3 SV=1 159 249 1.0E-21
sp|Q8LBK6|GRS15_ARATH Monothiol glutaredoxin-S15, mitochondrial OS=Arabidopsis thaliana GN=GRXS15 PE=1 SV=2 151 243 2.0E-21
sp|P0AC72|GLRX4_SHIFL Glutaredoxin-4 OS=Shigella flexneri GN=grxD PE=3 SV=1 161 245 2.0E-21
sp|P0AC69|GLRX4_ECOLI Glutaredoxin-4 OS=Escherichia coli (strain K12) GN=grxD PE=1 SV=1 161 245 2.0E-21
sp|P0AC70|GLRX4_ECOL6 Glutaredoxin-4 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=grxD PE=3 SV=1 161 245 2.0E-21
sp|P0AC71|GLRX4_ECO57 Glutaredoxin-4 OS=Escherichia coli O157:H7 GN=grxD PE=3 SV=1 161 245 2.0E-21
sp|Q1XDA3|YCF64_PYRYE Uncharacterized monothiol glutaredoxin ycf64 OS=Pyropia yezoensis GN=ycf64 PE=3 SV=1 162 249 4.0E-21
sp|Q9CMN5|GLRX4_PASMU Glutaredoxin-4 OS=Pasteurella multocida (strain Pm70) GN=grxD PE=3 SV=1 163 250 5.0E-21
sp|O30824|GLRX4_HAEDU Glutaredoxin-4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=grxD PE=3 SV=1 163 250 9.0E-21
sp|O05957|GLRX2_RICPR Probable monothiol glutaredoxin-2 OS=Rickettsia prowazekii (strain Madrid E) GN=grxC2 PE=3 SV=2 164 245 1.0E-20
sp|Q8H7F6|GRS16_ARATH Bifunctional monothiol glutaredoxin-S16, chloroplastic OS=Arabidopsis thaliana GN=GRXS16 PE=1 SV=2 114 249 2.0E-20
sp|Q4UK94|GLRX2_RICFE Probable monothiol glutaredoxin-2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=grxC2 PE=3 SV=1 161 245 7.0E-20
sp|Q48833|GLRXA_LEGPH Probable monothiol glutaredoxin GrlA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=grlA PE=3 SV=1 174 248 1.0E-19
sp|Q2QX01|GRS12_ORYSJ Monothiol glutaredoxin-S12, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXS12 PE=2 SV=1 140 243 2.0E-19
sp|Q4QLD2|GLRX4_HAEI8 Glutaredoxin-4 OS=Haemophilus influenzae (strain 86-028NP) GN=grxD PE=3 SV=2 161 245 2.0E-19
sp|P45085|GLRX4_HAEIN Glutaredoxin-4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=grxD PE=3 SV=2 161 245 1.0E-18
sp|P51384|YCF64_PORPU Uncharacterized monothiol glutaredoxin ycf64 OS=Porphyra purpurea GN=ycf64 PE=3 SV=1 162 249 7.0E-18
sp|Q555C8|GLRX5_DICDI Monothiol glutaredoxin-5, mitochondrial OS=Dictyostelium discoideum GN=grx5 PE=3 SV=1 168 243 9.0E-18
sp|Q0JM76|GRXS4_ORYSJ Monothiol glutaredoxin-S4, mitochondrial OS=Oryza sativa subsp. japonica GN=GRXS4 PE=2 SV=1 168 243 3.0E-17
sp|Q0JQ97|GRXS1_ORYSJ Monothiol glutaredoxin-S1, mitochondrial OS=Oryza sativa subsp. japonica GN=GRXS1 PE=2 SV=2 164 243 1.0E-16
sp|Q9TW67|NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 9 129 9.0E-12
sp|Q9LXZ8|TRH10_ARATH Putative thioredoxin H10 OS=Arabidopsis thaliana GN=At3g56420 PE=3 SV=2 12 113 1.0E-11
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 12 118 3.0E-11
sp|Q96419|TRXH_FAGES Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1 14 118 6.0E-11
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 12 118 9.0E-11
sp|O64394|TRXH_WHEAT Thioredoxin H-type OS=Triticum aestivum PE=2 SV=3 12 118 2.0E-10
sp|A2YIW7|TRXH_ORYSI Thioredoxin H-type OS=Oryza sativa subsp. indica GN=TRXH PE=1 SV=1 16 128 4.0E-10
sp|Q0D840|TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica GN=TRXH PE=1 SV=1 16 128 4.0E-10
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 6 118 5.0E-10
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 11 109 6.0E-10
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 15 123 2.0E-09
sp|Q07090|TRXH2_TOBAC Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1 12 123 2.0E-09
sp|P85801|TRXH_POPJC Thioredoxin H-type OS=Populus jackii PE=1 SV=1 12 114 4.0E-09
sp|Q9Z7P5|THIO_CHLPN Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 9 104 5.0E-09
sp|Q9XIF4|TRXH7_ARATH Thioredoxin H7 OS=Arabidopsis thaliana GN=TRX7 PE=2 SV=1 1 117 5.0E-09
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 27 117 5.0E-09
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 9 117 5.0E-09
sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1 14 117 7.0E-09
sp|P29449|TRXH1_TOBAC Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1 14 118 8.0E-09
sp|P29448|TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1 14 117 9.0E-09
sp|P25372|TRX3_YEAST Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX3 PE=1 SV=1 5 115 9.0E-09
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 8 130 1.0E-08
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 27 105 1.0E-08
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 11 129 2.0E-08
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 12 118 2.0E-08
sp|P96611|YDBP_BACSU Thioredoxin-like protein YdbP OS=Bacillus subtilis (strain 168) GN=ydbP PE=2 SV=1 9 107 2.0E-08
sp|O94504|TRX2_SCHPO Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 2 105 3.0E-08
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 7 114 3.0E-08
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 27 117 3.0E-08
sp|Q9CAS1|TRXH8_ARATH Thioredoxin H8 OS=Arabidopsis thaliana GN=TRX8 PE=2 SV=1 9 104 3.0E-08
sp|Q43636|TRXH_RICCO Thioredoxin H-type OS=Ricinus communis PE=3 SV=1 14 123 5.0E-08
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 25 105 5.0E-08
sp|Q38879|TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 7 105 5.0E-08
sp|Q8GXV2|CXXS2_ARATH Thioredoxin-like protein CXXS2 OS=Arabidopsis thaliana GN=CXXS2 PE=2 SV=1 12 136 1.0E-07
sp|O65049|TRXH_PICMA Thioredoxin H-type OS=Picea mariana GN=SB09 PE=2 SV=1 20 106 1.0E-07
sp|P60226|THIO1_DROYA Thioredoxin-1 OS=Drosophila yakuba GN=dhd PE=2 SV=2 30 110 1.0E-07
sp|Q39239|TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2 16 117 2.0E-07
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 6 104 3.0E-07
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 6 104 3.0E-07
sp|Q0DKF1|TRH42_ORYSJ Thioredoxin H4-2 OS=Oryza sativa subsp. japonica GN=Os05g0169000 PE=2 SV=1 12 121 5.0E-07
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 9 96 6.0E-07
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 27 104 6.0E-07
sp|Q9AS75|TRH41_ORYSJ Thioredoxin H4-1 OS=Oryza sativa subsp. japonica GN=Os01g0168200 PE=2 SV=1 12 106 7.0E-07
sp|Q39241|TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana GN=TRX5 PE=1 SV=1 14 118 7.0E-07
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 25 105 8.0E-07
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 32 105 8.0E-07
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 32 105 8.0E-07
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 32 105 8.0E-07
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 32 105 8.0E-07
sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 28 118 8.0E-07
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 5 105 1.0E-06
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 9 104 2.0E-06
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 22 104 2.0E-06
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 18 105 2.0E-06
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 7 105 2.0E-06
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 25 105 4.0E-06
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 30 117 4.0E-06
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 17 105 7.0E-06
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 31 105 7.0E-06
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 31 105 8.0E-06
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 32 105 9.0E-06
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 32 105 9.0E-06
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 25 106 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0015035 protein-disulfide reductase activity No
GO:0003674 molecular_function No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0015036 disulfide oxidoreductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2404
MSAPSMSTMTEITSLDEWEQLLGSLPASTLAIVSFHAPWAAPCAQMATVLSTLAAEYPLTEPPSTAWVSVNAEEL
SDISETYNVTAVPYLVLLRNGRVVETVSGSSAVKVRTAIETHARGASSLPAAAAANGLPKQQEAVSPRDHEQCSV
PDAVTQKEDLFKRLAHLVKAAPVMLFMKGTPASPQCGFSRQMVGLLREHSVKYGFFNILADDEVRQGLKEYAEWP
TYPQLWIDGELVGGLDIVKEELESNPDYFKPYSVSNTCDTAAA*
Coding >OphauB2|2404
ATGAGCGCGCCCTCCATGTCTACCATGACGGAAATCACCTCGCTCGACGAGTGGGAACAGCTGCTGGGCTCGCTG
CCCGCCTCGACCCTCGCCATAGTCTCCTTTCACGCGCCATGGGCTGCGCCATGTGCCCAGATGGCTACTGTGCTC
TCGACGCTTGCCGCTGAATATCCCTTGACTGAGCCGCCTAGCACGGCCTGGGTCTCGGTCAATGCAGAGGAATTG
AGCGACATTAGCGAAACGTACAACGTGACGGCTGTTCCATACCTCGTTCTGCTTAGAAACGGCCGCGTCGTTGAG
ACGGTTAGCGGCAGCAGCGCTGTCAAGGTGCGGACAGCCATTGAGACGCATGCTCGTGGCGCCTCGAGCTTGCCA
GCAGCAGCAGCAGCCAACGGCCTGCCAAAACAGCAAGAGGCCGTGTCCCCGCGCGACCATGAGCAATGCAGCGTC
CCAGACGCAGTCACGCAAAAGGAAGATTTGTTTAAGCGACTGGCCCACCTTGTCAAGGCTGCACCCGTCATGCTG
TTTATGAAGGGCACTCCAGCTTCTCCGCAGTGTGGCTTCTCGCGACAAATGGTTGGCTTGTTGCGGGAGCATTCA
GTCAAGTATGGCTTCTTCAATATTTTGGCCGACGATGAGGTCCGGCAGGGCCTCAAGGAATATGCCGAGTGGCCG
ACATATCCCCAGCTTTGGATTGACGGCGAGCTCGTTGGTGGTTTGGACATTGTCAAGGAGGAGCTTGAAAGCAAC
CCTGACTACTTCAAGCCGTATAGCGTCAGCAACACGTGCGACACTGCCGCCGCCTGA
Transcript >OphauB2|2404
ATGAGCGCGCCCTCCATGTCTACCATGACGGAAATCACCTCGCTCGACGAGTGGGAACAGCTGCTGGGCTCGCTG
CCCGCCTCGACCCTCGCCATAGTCTCCTTTCACGCGCCATGGGCTGCGCCATGTGCCCAGATGGCTACTGTGCTC
TCGACGCTTGCCGCTGAATATCCCTTGACTGAGCCGCCTAGCACGGCCTGGGTCTCGGTCAATGCAGAGGAATTG
AGCGACATTAGCGAAACGTACAACGTGACGGCTGTTCCATACCTCGTTCTGCTTAGAAACGGCCGCGTCGTTGAG
ACGGTTAGCGGCAGCAGCGCTGTCAAGGTGCGGACAGCCATTGAGACGCATGCTCGTGGCGCCTCGAGCTTGCCA
GCAGCAGCAGCAGCCAACGGCCTGCCAAAACAGCAAGAGGCCGTGTCCCCGCGCGACCATGAGCAATGCAGCGTC
CCAGACGCAGTCACGCAAAAGGAAGATTTGTTTAAGCGACTGGCCCACCTTGTCAAGGCTGCACCCGTCATGCTG
TTTATGAAGGGCACTCCAGCTTCTCCGCAGTGTGGCTTCTCGCGACAAATGGTTGGCTTGTTGCGGGAGCATTCA
GTCAAGTATGGCTTCTTCAATATTTTGGCCGACGATGAGGTCCGGCAGGGCCTCAAGGAATATGCCGAGTGGCCG
ACATATCCCCAGCTTTGGATTGACGGCGAGCTCGTTGGTGGTTTGGACATTGTCAAGGAGGAGCTTGAAAGCAAC
CCTGACTACTTCAAGCCGTATAGCGTCAGCAACACGTGCGACACTGCCGCCGCCTGA
Gene >OphauB2|2404
ATGAGCGCGCCCTCCATGTCTACCATGACGGAAATCACCTCGCTCGACGAGTGGGAACAGCTGCTGGGCTCGCTG
CCCGCCTCGACCCTCGCCATAGTCTCCTTTCACGCGCCATGGGCTGCGCCATGTGCCCAGATGGCTACTGTGCTC
TCGACGCTTGCCGCTGAATATCCCTTGACTGAGCCGCCTAGCACGGCCTGGGTCTCGGTCAATGCAGAGGAATTG
AGCGACATTAGCGAAACGTACAACGTGACGGCTGTTCCATACCTCGTTCTGCTTAGAAACGGCCGCGTCGTTGAG
ACGGTTAGCGGCAGCAGCGCTGTCAAGGTGCGGACAGCCATTGAGACGCATGCTCGTGGCGCCTCGAGCTTGCCA
GCAGCAGCAGCAGCCAACGGCCTGCCAAAACAGCAAGAGGCCGTGTCCCCGCGCGACCATGAGCAATGCAGCGTC
CCAGACGCAGTCACGCAAAAGGAAGATTTGTTTAAGCGACTGGCCCACCTTGTCAAGGCTGCACCCGTCATGCTG
TTTATGAAGGGCACTCCAGCTTCTCCGCAGTGTGGCTTCTCGCGACAAATGGTTGGCTTGTTGCGGGAGCATTCA
GTCAAGTATGGCTTCTTCAATATTTTGGCCGACGATGAGGTCCGGCAGGGCCTCAAGGAATATGCCGAGTGGCCG
ACATATCCCCAGCTTTGGATTGACGGCGAGCTCGTTGGTGGTTTGGACATTGTGAGCTGATTTCTTTCCCCGTCG
CTGTCGAGCCGACTGACAGGTGTGCCTAGGTCAAGGAGGAGCTTGAAAGCAACCCTGACTACTTCAAGCCGTATA
GCGTCAGCAACACGTGCGACACTGCCGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail