Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2393
Gene name
LocationContig_174:28307..31028
Strand+
Gene length (bp)2721
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.2E-16 608 695
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.1E-11 738 788

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 443 839 3.0E-105
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 441 838 1.0E-95
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 446 838 6.0E-92
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 417 845 2.0E-43
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 446 847 2.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 443 839 3.0E-105
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 441 838 1.0E-95
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 446 838 6.0E-92
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 417 845 2.0E-43
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 446 847 2.0E-39
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 433 847 3.0E-38
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 446 841 1.0E-36
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 446 788 6.0E-36
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 471 869 4.0E-32
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 471 869 1.0E-31
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 446 815 1.0E-31
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 446 815 1.0E-31
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 501 825 4.0E-31
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 501 849 2.0E-30
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 503 873 2.0E-30
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 501 825 3.0E-30
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 503 873 3.0E-30
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 502 801 4.0E-29
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 502 801 4.0E-29
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 501 848 1.0E-28
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 506 848 7.0E-28
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 505 802 3.0E-27
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 414 801 6.0E-27
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 488 793 4.0E-26
sp|A3KGB4|TBC8B_MOUSE TBC1 domain family member 8B OS=Mus musculus GN=Tbc1d8b PE=1 SV=1 503 796 1.0E-25
sp|B0R0W9|TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio GN=tbc1d8b PE=3 SV=1 500 801 2.0E-25
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 513 788 4.0E-25
sp|Q0IIM8|TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens GN=TBC1D8B PE=1 SV=2 503 796 1.0E-24
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 505 825 2.0E-24
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 503 815 2.0E-24
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 446 815 5.0E-24
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 441 848 7.0E-24
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 503 859 9.0E-24
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 499 861 2.0E-23
sp|Q09445|GRTP6_CAEEL Growth hormone-regulated TBC protein 6 OS=Caenorhabditis elegans GN=tbc-6 PE=3 SV=3 459 804 4.0E-23
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 501 850 2.0E-22
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 505 825 4.0E-22
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 505 825 2.0E-21
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 499 840 2.0E-21
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 499 840 3.0E-21
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 499 861 2.0E-20
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 499 840 7.0E-20
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 475 847 3.0E-18
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 478 810 2.0E-17
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 614 814 3.0E-17
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 511 819 4.0E-17
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 614 814 2.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2393
MAISRVDAQDQNQTGIASQDPLYSSRIRPSTAPMTVHQASATALLPEMPSLSPLAISTRWDSPLNSPRFINHSPT
SPKLPRWDAWPDRQPPLQPAFGSAQTTDTDFQYKSPSRPATAKSHVGPEGVAVENFSRPRKLSIRQPNVTDRTTH
VSNAANLTPADLLSVSSSRSAGAFSPPRGPRLADSRLPRPRNVPGVAVRLPFSSSATRIDTYWPGPPGSGAVLPW
MTGEEPRSSFRSQLSSSTAFGTAATERSSSVLTKDTSITSLYMYSHPDEPSLEDVMGMYEKGFVDDEDDHGAAAT
HAADAPGRRVRLDFHRPIPTAPEKFQFESNPSSDSDVAQMPSSRSALDAEIRKSKLLFASPAFTSSVPALSGDDD
DFATEKRDSGKSLDSDPSIVSASHEMKKSTAIVTIPASATLDTSAREPEPTSPRPVPDSAILEAEDPGSRDRYGF
KKKNQYINREQYDAWNNGYSQYLSRRRKKWVTYLKDCSLMTDHPIRFPPANAKTKRFVRKGIPPDWRGAAWFYYA
GGPAILAKHSGLYEKLLRSEAKEVDVEAIERDLHRTFPDNIQFQPTSYHCSTSSSDASSPPVRTPSTSSNGSRPG
PAGLEGEPPIISSLRRVLHAFAIYNPRIGYCQSLNFLAGLLLLFVETEEQCFWLLNVITIIYLPGTHDMSLEGSK
VDLGVLMTELRDTMPDVWDKIGGELEGGPAQRPSTSKSLRTPKAMRRRRNQPGLSTERLPPITLCMTAWFMSCFI
GTLPIETTLRVWDVFFYEGSKTLFRIALSIFKTGESEIKAVSDPMEMFSVVQSLPRRMLDANALIETCFKRRNGF
GHLSQAAIDDRRQERRERTIQELRNKLATSGNVAELEVEHAPRMGAFFSMRRRDLSRPRAAEA*
Coding >OphauB2|2393
ATGGCCATTTCCCGTGTCGATGCACAGGACCAAAATCAGACTGGAATTGCGAGTCAAGACCCTCTCTACTCGTCG
CGCATCCGTCCATCCACTGCACCCATGACAGTCCATCAAGCATCGGCCACGGCCTTGCTACCAGAGATGCCCTCA
CTCTCACCGCTTGCAATATCCACGCGCTGGGATTCGCCCTTAAACAGCCCTCGTTTCATCAATCATAGCCCGACC
TCGCCCAAGCTGCCTAGATGGGATGCATGGCCGGATCGTCAACCCCCCTTGCAGCCAGCGTTCGGCTCAGCCCAA
ACCACGGATACCGACTTTCAGTACAAGTCTCCATCAAGGCCCGCGACTGCCAAGTCTCATGTCGGGCCTGAAGGA
GTCGCCGTAGAGAATTTTTCTCGGCCCCGGAAGCTCAGTATTCGCCAGCCTAATGTGACGGACCGCACCACCCAT
GTGTCAAATGCGGCAAACCTGACACCAGCCGACCTGCTTTCAGTCTCATCTTCCAGATCTGCTGGCGCCTTTTCA
CCTCCCCGAGGTCCTCGTTTAGCTGACTCTAGGCTTCCTCGTCCTCGCAATGTTCCTGGAGTTGCTGTTCGGCTA
CCATTCTCTTCAAGCGCTACGCGTATTGATACTTATTGGCCTGGCCCCCCGGGTAGTGGGGCGGTGCTGCCCTGG
ATGACCGGGGAGGAGCCGCGGTCCAGTTTCAGATCTCAGCTGAGTTCCTCGACTGCTTTCGGCACCGCCGCGACG
GAACGAAGTAGTAGTGTTTTGACAAAGGACACCTCAATTACTTCTCTATATATGTACAGCCATCCTGACGAACCT
AGCTTGGAAGACGTCATGGGCATGTATGAAAAAGGATTTGTCGATGACGAAGACGACCACGGAGCCGCTGCAACA
CATGCTGCCGACGCACCTGGCCGTCGCGTTCGCCTAGACTTTCACCGTCCTATCCCCACAGCCCCTGAAAAATTT
CAGTTCGAGAGCAACCCGTCCTCCGATTCTGACGTTGCACAAATGCCTTCATCCCGCTCGGCGCTCGACGCAGAA
ATTCGAAAATCTAAATTGCTCTTTGCCAGCCCTGCATTTACCTCATCCGTTCCCGCCCTATCTGGGGACGATGAC
GACTTTGCTACTGAAAAGCGAGACTCGGGGAAATCTCTTGACTCTGATCCATCCATTGTCTCTGCAAGCCATGAG
ATGAAGAAGTCGACGGCCATTGTGACAATCCCTGCATCTGCCACCCTCGACACTTCAGCCAGGGAACCGGAACCA
ACTTCTCCTAGGCCGGTCCCCGATAGCGCTATCTTGGAGGCTGAAGATCCAGGTTCACGCGACCGCTATGGTTTT
AAGAAGAAAAATCAGTACATCAATAGGGAACAATACGATGCCTGGAACAATGGCTATTCGCAGTATCTGTCTCGT
CGACGCAAAAAGTGGGTGACGTACCTCAAAGACTGTTCATTAATGACAGACCACCCCATTCGCTTTCCACCGGCC
AACGCAAAGACGAAGCGATTTGTGCGCAAGGGCATCCCGCCAGACTGGAGAGGCGCCGCATGGTTCTACTATGCG
GGTGGTCCCGCTATACTTGCAAAGCACTCGGGGCTCTACGAGAAGCTATTGCGCAGCGAGGCCAAAGAAGTCGAC
GTCGAGGCCATTGAGAGGGATCTCCATCGGACATTTCCTGACAATATTCAGTTTCAGCCCACGTCGTACCATTGC
TCTACTTCCAGTAGCGATGCCAGCAGTCCGCCAGTTCGGACACCGTCGACGTCGAGCAACGGAAGCAGGCCAGGC
CCAGCAGGCCTGGAAGGCGAACCGCCCATCATTTCGTCACTACGTCGAGTTTTGCATGCATTTGCCATATACAAT
CCACGCATTGGGTATTGCCAGAGCCTTAATTTCCTGGCCGGCTTGCTACTGCTCTTTGTGGAGACTGAGGAGCAG
TGCTTTTGGCTTCTCAATGTCATCACCATCATTTATCTCCCTGGAACACACGATATGAGTCTTGAGGGCTCCAAA
GTGGACTTGGGCGTATTGATGACGGAGCTACGGGATACAATGCCCGATGTTTGGGACAAAATTGGCGGCGAGCTG
GAAGGTGGCCCTGCGCAAAGACCATCGACGAGCAAATCACTTCGGACCCCAAAGGCAATGCGAAGACGGCGAAAC
CAACCGGGCCTGTCGACGGAGCGATTACCCCCCATTACGTTGTGCATGACTGCGTGGTTCATGAGCTGTTTTATT
GGCACCCTGCCCATTGAGACAACGCTGCGTGTCTGGGATGTCTTCTTCTATGAGGGCTCCAAGACATTGTTTCGA
ATAGCCTTGTCCATCTTCAAAACCGGAGAGTCTGAGATCAAGGCCGTGTCGGACCCAATGGAGATGTTTAGCGTG
GTGCAGTCGCTGCCACGTCGCATGCTCGACGCCAATGCACTTATAGAGACGTGTTTCAAGCGACGCAACGGCTTT
GGCCATCTCAGTCAGGCAGCCATTGACGATCGTCGGCAAGAACGTCGCGAGCGCACAATACAAGAGTTGAGGAAC
AAGCTGGCGACCAGTGGCAACGTTGCCGAGTTGGAAGTTGAGCATGCGCCCCGGATGGGCGCCTTTTTTTCCATG
CGACGCAGAGACTTGTCAAGGCCACGGGCGGCAGAAGCTTAG
Transcript >OphauB2|2393
ATGGCCATTTCCCGTGTCGATGCACAGGACCAAAATCAGACTGGAATTGCGAGTCAAGACCCTCTCTACTCGTCG
CGCATCCGTCCATCCACTGCACCCATGACAGTCCATCAAGCATCGGCCACGGCCTTGCTACCAGAGATGCCCTCA
CTCTCACCGCTTGCAATATCCACGCGCTGGGATTCGCCCTTAAACAGCCCTCGTTTCATCAATCATAGCCCGACC
TCGCCCAAGCTGCCTAGATGGGATGCATGGCCGGATCGTCAACCCCCCTTGCAGCCAGCGTTCGGCTCAGCCCAA
ACCACGGATACCGACTTTCAGTACAAGTCTCCATCAAGGCCCGCGACTGCCAAGTCTCATGTCGGGCCTGAAGGA
GTCGCCGTAGAGAATTTTTCTCGGCCCCGGAAGCTCAGTATTCGCCAGCCTAATGTGACGGACCGCACCACCCAT
GTGTCAAATGCGGCAAACCTGACACCAGCCGACCTGCTTTCAGTCTCATCTTCCAGATCTGCTGGCGCCTTTTCA
CCTCCCCGAGGTCCTCGTTTAGCTGACTCTAGGCTTCCTCGTCCTCGCAATGTTCCTGGAGTTGCTGTTCGGCTA
CCATTCTCTTCAAGCGCTACGCGTATTGATACTTATTGGCCTGGCCCCCCGGGTAGTGGGGCGGTGCTGCCCTGG
ATGACCGGGGAGGAGCCGCGGTCCAGTTTCAGATCTCAGCTGAGTTCCTCGACTGCTTTCGGCACCGCCGCGACG
GAACGAAGTAGTAGTGTTTTGACAAAGGACACCTCAATTACTTCTCTATATATGTACAGCCATCCTGACGAACCT
AGCTTGGAAGACGTCATGGGCATGTATGAAAAAGGATTTGTCGATGACGAAGACGACCACGGAGCCGCTGCAACA
CATGCTGCCGACGCACCTGGCCGTCGCGTTCGCCTAGACTTTCACCGTCCTATCCCCACAGCCCCTGAAAAATTT
CAGTTCGAGAGCAACCCGTCCTCCGATTCTGACGTTGCACAAATGCCTTCATCCCGCTCGGCGCTCGACGCAGAA
ATTCGAAAATCTAAATTGCTCTTTGCCAGCCCTGCATTTACCTCATCCGTTCCCGCCCTATCTGGGGACGATGAC
GACTTTGCTACTGAAAAGCGAGACTCGGGGAAATCTCTTGACTCTGATCCATCCATTGTCTCTGCAAGCCATGAG
ATGAAGAAGTCGACGGCCATTGTGACAATCCCTGCATCTGCCACCCTCGACACTTCAGCCAGGGAACCGGAACCA
ACTTCTCCTAGGCCGGTCCCCGATAGCGCTATCTTGGAGGCTGAAGATCCAGGTTCACGCGACCGCTATGGTTTT
AAGAAGAAAAATCAGTACATCAATAGGGAACAATACGATGCCTGGAACAATGGCTATTCGCAGTATCTGTCTCGT
CGACGCAAAAAGTGGGTGACGTACCTCAAAGACTGTTCATTAATGACAGACCACCCCATTCGCTTTCCACCGGCC
AACGCAAAGACGAAGCGATTTGTGCGCAAGGGCATCCCGCCAGACTGGAGAGGCGCCGCATGGTTCTACTATGCG
GGTGGTCCCGCTATACTTGCAAAGCACTCGGGGCTCTACGAGAAGCTATTGCGCAGCGAGGCCAAAGAAGTCGAC
GTCGAGGCCATTGAGAGGGATCTCCATCGGACATTTCCTGACAATATTCAGTTTCAGCCCACGTCGTACCATTGC
TCTACTTCCAGTAGCGATGCCAGCAGTCCGCCAGTTCGGACACCGTCGACGTCGAGCAACGGAAGCAGGCCAGGC
CCAGCAGGCCTGGAAGGCGAACCGCCCATCATTTCGTCACTACGTCGAGTTTTGCATGCATTTGCCATATACAAT
CCACGCATTGGGTATTGCCAGAGCCTTAATTTCCTGGCCGGCTTGCTACTGCTCTTTGTGGAGACTGAGGAGCAG
TGCTTTTGGCTTCTCAATGTCATCACCATCATTTATCTCCCTGGAACACACGATATGAGTCTTGAGGGCTCCAAA
GTGGACTTGGGCGTATTGATGACGGAGCTACGGGATACAATGCCCGATGTTTGGGACAAAATTGGCGGCGAGCTG
GAAGGTGGCCCTGCGCAAAGACCATCGACGAGCAAATCACTTCGGACCCCAAAGGCAATGCGAAGACGGCGAAAC
CAACCGGGCCTGTCGACGGAGCGATTACCCCCCATTACGTTGTGCATGACTGCGTGGTTCATGAGCTGTTTTATT
GGCACCCTGCCCATTGAGACAACGCTGCGTGTCTGGGATGTCTTCTTCTATGAGGGCTCCAAGACATTGTTTCGA
ATAGCCTTGTCCATCTTCAAAACCGGAGAGTCTGAGATCAAGGCCGTGTCGGACCCAATGGAGATGTTTAGCGTG
GTGCAGTCGCTGCCACGTCGCATGCTCGACGCCAATGCACTTATAGAGACGTGTTTCAAGCGACGCAACGGCTTT
GGCCATCTCAGTCAGGCAGCCATTGACGATCGTCGGCAAGAACGTCGCGAGCGCACAATACAAGAGTTGAGGAAC
AAGCTGGCGACCAGTGGCAACGTTGCCGAGTTGGAAGTTGAGCATGCGCCCCGGATGGGCGCCTTTTTTTCCATG
CGACGCAGAGACTTGTCAAGGCCACGGGCGGCAGAAGCTTAG
Gene >OphauB2|2393
ATGGCCATTTCCCGTGTCGATGCACAGGACCAAAATCAGACTGGAATTGCGAGTCAAGACCCTCTCTACTCGTCG
CGCATCCGTCCATCCACTGCACCCATGACAGTCCATCAAGCATCGGCCACGGCCTTGCTACCAGAGATGCCCTCA
CTCTCACCGCTTGCAATATCCACGCGCTGGGATTCGCCCTTAAACAGCCCTCGTTTCATCAATCATAGCCCGACC
TCGCCCAAGCTGCCTAGATGGGATGCATGGCCGGATCGTCAACCCCCCTTGCAGCCAGCGTTCGGCTCAGCCCAA
ACCACGGATACCGACTTTCAGTACAAGTCTCCATCAAGGCCCGCGACTGCCAAGTCTCATGTCGGGCCTGAAGGA
GTCGCCGTAGAGAATTTTTCTCGGCCCCGGAAGCTCAGTATTCGCCAGCCTAATGTGACGGACCGCACCACCCAT
GTGTCAAATGCGGCAAACCTGACACCAGCCGACCTGGTACATGACGGCACATCCCGGACACCCCTCCTGTATCAC
TCGACACGGAGACAGCTTTCAGTCTCATCTTCCAGATCTGCTGGCGCCTTTTCACCTCCCCGAGGTCCTCGTTTA
GCTGACTCTAGGCTTCCTCGTCCTCGCAATGTTCCTGGAGTTGCTGTTCGGCTACCATTCTCTTCAAGCGCTACG
CGTATTGATACTTATTGGCCTGGCCCCCCGGGTAGTGGGGCGGTGCTGCCCTGGATGACCGGGGAGGAGCCGCGG
TCCAGTTTCAGATCTCAGCTGAGTTCCTCGACTGCTTTCGGCACCGCCGCGACGGAACGAAGTAGTAGTGTTTTG
ACAAAGGACACCTCAATTACTTCTCTATATATGTACAGCCATCCTGACGAACCTAGCTTGGAAGACGTCATGGGC
ATGTATGAAAAAGGATTTGTCGATGACGAAGACGACCACGGAGCCGCTGCAACACATGCTGCCGACGCACCTGGC
CGTCGCGTTCGCCTAGACTTTCACCGTCCTATCCCCACAGCCCCTGAAAAATTTCAGTTCGAGAGCAACCCGTCC
TCCGATTCTGACGTTGCACAAATGCCTTCATCCCGCTCGGCGCTCGACGCAGAAATTCGAAAATCTAAATTGCTC
TTTGCCAGCCCTGCATTTACCTCATCCGTTCCCGCCCTATCTGGGGACGATGACGACTTTGCTACTGAAAAGCGA
GACTCGGGGAAATCTCTTGACTCTGATCCATCCATTGTCTCTGCAAGCCATGAGATGAAGAAGTCGACGGCCATT
GTGACAATCCCTGCATCTGCCACCCTCGACACTTCAGCCAGGGAACCGGAACCAACTTCTCCTAGGCCGGTCCCC
GATAGCGCTATCTTGGAGGCTGAAGATCCAGGTTCACGCGACCGCTATGGTTTTAAGAAGAAAAATCAGTACATC
AATAGGGAACAATACGATGCCTGGAACAATGGCTATTCGCAGTATCTGTCTCGTCGACGCAAAAAGTGGGTGACG
TACCTCAAAGACTGTTCATTAATGACAGACCACCCCATTCGCTTTCCACCGGCCAACGCAAAGACGAAGCGATTT
GTGCGCAAGGGCATCCCGCCAGACTGGAGAGGCGCCGCATGGTTCTACTATGCGGGTGGTCCCGCTATACTTGCA
AAGCACTCGGGGCTCTACGAGAAGCTATTGCGCAGCGAGGCCAAAGAAGTCGACGTCGAGGCCATTGAGAGGGAT
CTCCATCGGACATTTCCTGACAATATTCAGTTTCAGCCCACGTCGTACCATTGCTCTACTTCCAGTAGCGATGCC
AGCAGTCCGCCAGTTCGGACACCGTCGACGTCGAGCAACGGAAGCAGGCCAGGCCCAGCAGGCCTGGAAGGCGAA
CCGCCCATCATTTCGTCACTACGTCGAGTTTTGCATGCATTTGCCATATACAATCCACGCATTGGGTATTGCCAG
AGCCTTAATTTCCTGGCCGGCTTGCTACTGCTCTTTGTGGAGACTGAGGAGCAGTGCTTTTGGCTTCTCAATGTC
ATCACCATCATTTATCTCCCTGGAACACACGATATGAGTCTTGAGGGCTCCAAAGTGGACTTGGGCGTATTGATG
ACGGAGCTACGGGATACAATGCCCGATGTTTGGGACAAAATTGGCGGCGAGCTGGAAGGTGGCCCTGCGCAAAGA
CCATCGACGAGCAAATCACTTCGGACCCCAAAGGCAATGCGAAGACGGCGAAACCAACCGGGCCTGTCGACGGAG
CGATTACCCCCCATTACGTTGTGCATGACTGCGTGGTTCATGAGCTGTTTTATTGGCACCCTGCCCATTGAGACA
ACGCTGCGTGTCTGGGATGTCTTCTTCTATGAGGGCTCCAAGACATTGTTTCGAATAGCCTTGTCCATCTTCAAA
ACCGGAGAGTCTGAGATCAAGGCCGTGTCGGACCCAATGGAGATGTTTAGCGTGGTGCAGTCGCTGCCACGTCGC
ATGCTCGACGCCAATGCACTTATAGAGACGTGTTTCAAGCGACGCAACGGCTTTGGCCATCTCAGTCAGGCAGCC
ATTGACGATCGTCGGCAAGAACGTCGCGAGCGCACAATACAAGAGTTGAGGAACAAGCTGGCGACCAGTGGCAAC
GTTGCCGAGTTGGAAGTTGAGCATGCGCCCCGGATGGGCGCCTTTTTTTCCATGCGACGCAGAGACTTGTCAAGG
CCACGGGCGGCAGAAGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail