Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2392
Gene name
LocationContig_174:22105..23939
Strand+
Gene length (bp)1834
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00266 Aminotran_5 Aminotransferase class-V 1.1E-10 9 95
PF00266 Aminotran_5 Aminotransferase class-V 4.7E-20 165 413

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33330|SERC_YEAST Phosphoserine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER1 PE=1 SV=1 4 425 4.0E-106
sp|Q10349|SERC_SCHPO Putative phosphoserine aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.07 PE=3 SV=1 1 425 4.0E-84
sp|Q99K85|SERC_MOUSE Phosphoserine aminotransferase OS=Mus musculus GN=Psat1 PE=1 SV=1 1 424 1.0E-83
sp|Q9Y617|SERC_HUMAN Phosphoserine aminotransferase OS=Homo sapiens GN=PSAT1 PE=1 SV=2 1 424 2.0E-81
sp|P10658|SERC_RABIT Phosphoserine aminotransferase OS=Oryctolagus cuniculus GN=PSAT1 PE=2 SV=1 1 424 6.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33330|SERC_YEAST Phosphoserine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER1 PE=1 SV=1 4 425 4.0E-106
sp|Q10349|SERC_SCHPO Putative phosphoserine aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.07 PE=3 SV=1 1 425 4.0E-84
sp|Q99K85|SERC_MOUSE Phosphoserine aminotransferase OS=Mus musculus GN=Psat1 PE=1 SV=1 1 424 1.0E-83
sp|Q9Y617|SERC_HUMAN Phosphoserine aminotransferase OS=Homo sapiens GN=PSAT1 PE=1 SV=2 1 424 2.0E-81
sp|P10658|SERC_RABIT Phosphoserine aminotransferase OS=Oryctolagus cuniculus GN=PSAT1 PE=2 SV=1 1 424 6.0E-80
sp|A8H4A2|SERC_SHEPA Phosphoserine aminotransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=serC PE=3 SV=1 5 425 1.0E-78
sp|Q8Y0Z0|SERC_RALSO Phosphoserine aminotransferase OS=Ralstonia solanacearum (strain GMI1000) GN=serC PE=3 SV=1 3 427 1.0E-78
sp|B0TT41|SERC_SHEHH Phosphoserine aminotransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=serC PE=3 SV=1 5 425 2.0E-77
sp|Q5QZ48|SERC_IDILO Phosphoserine aminotransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=serC PE=3 SV=1 5 424 3.0E-77
sp|Q9VAN0|SERC_DROME Probable phosphoserine aminotransferase OS=Drosophila melanogaster GN=CG11899 PE=2 SV=1 10 424 3.0E-77
sp|Q820S0|SERC_NITEU Phosphoserine aminotransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=serC PE=3 SV=1 6 424 8.0E-76
sp|B8CMG9|SERC_SHEPW Phosphoserine aminotransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=serC PE=3 SV=1 10 425 9.0E-76
sp|C1D8N3|SERC_LARHH Phosphoserine aminotransferase OS=Laribacter hongkongensis (strain HLHK9) GN=serC PE=3 SV=1 7 425 9.0E-76
sp|A1S6D1|SERC_SHEAM Phosphoserine aminotransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=serC PE=3 SV=1 5 425 2.0E-75
sp|B2U882|SERC_RALPJ Phosphoserine aminotransferase OS=Ralstonia pickettii (strain 12J) GN=serC PE=3 SV=1 3 424 5.0E-75
sp|B1YV30|SERC_BURA4 Phosphoserine aminotransferase OS=Burkholderia ambifaria (strain MC40-6) GN=serC PE=3 SV=1 10 424 2.0E-74
sp|Q55CQ6|SERC_DICDI Probable phosphoserine aminotransferase OS=Dictyostelium discoideum GN=serC PE=3 SV=1 7 424 2.0E-74
sp|Q59196|SERC_BACCI Phosphoserine aminotransferase OS=Bacillus circulans GN=serC PE=1 SV=3 10 424 3.0E-74
sp|Q0BH96|SERC_BURCM Phosphoserine aminotransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=serC PE=3 SV=1 10 424 7.0E-74
sp|B2JF00|SERC_BURP8 Phosphoserine aminotransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=serC PE=3 SV=1 10 424 2.0E-73
sp|B4EB45|SERC_BURCJ Phosphoserine aminotransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=serC PE=3 SV=1 10 424 3.0E-73
sp|A6T1G7|SERC_JANMA Phosphoserine aminotransferase OS=Janthinobacterium sp. (strain Marseille) GN=serC PE=3 SV=1 10 424 3.0E-73
sp|A4JCH1|SERC_BURVG Phosphoserine aminotransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=serC PE=3 SV=1 10 424 4.0E-73
sp|A0K5L8|SERC_BURCH Phosphoserine aminotransferase OS=Burkholderia cenocepacia (strain HI2424) GN=serC PE=3 SV=1 10 424 6.0E-73
sp|Q1BY31|SERC_BURCA Phosphoserine aminotransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=serC PE=3 SV=1 10 424 6.0E-73
sp|Q0HIX3|SERC_SHESM Phosphoserine aminotransferase OS=Shewanella sp. (strain MR-4) GN=serC PE=3 SV=1 5 425 8.0E-73
sp|B1JXR6|SERC_BURCC Phosphoserine aminotransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=serC PE=3 SV=1 10 424 1.0E-72
sp|A0KWN5|SERC_SHESA Phosphoserine aminotransferase OS=Shewanella sp. (strain ANA-3) GN=serC PE=3 SV=1 5 425 3.0E-72
sp|Q39IG4|SERC_BURL3 Phosphoserine aminotransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=serC PE=3 SV=1 10 424 3.0E-72
sp|Q0HV09|SERC_SHESR Phosphoserine aminotransferase OS=Shewanella sp. (strain MR-7) GN=serC PE=3 SV=1 5 425 5.0E-72
sp|B1HSU6|SERC_LYSSC Phosphoserine aminotransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=serC PE=3 SV=1 10 424 5.0E-72
sp|B2T637|SERC_BURPP Phosphoserine aminotransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=serC PE=3 SV=1 10 424 6.0E-72
sp|Q12MU6|SERC_SHEDO Phosphoserine aminotransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=serC PE=3 SV=1 5 425 8.0E-72
sp|A4XTE7|SERC_PSEMY Phosphoserine aminotransferase OS=Pseudomonas mendocina (strain ymp) GN=serC PE=3 SV=1 10 424 1.0E-71
sp|A1TSA3|SERC_ACIAC Phosphoserine aminotransferase OS=Acidovorax citrulli (strain AAC00-1) GN=serC PE=3 SV=1 10 424 2.0E-71
sp|A9ADV9|SERC_BURM1 Phosphoserine aminotransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=serC PE=3 SV=1 10 424 3.0E-71
sp|A6VZ92|SERC_MARMS Phosphoserine aminotransferase OS=Marinomonas sp. (strain MWYL1) GN=serC PE=3 SV=1 5 424 3.0E-71
sp|A1RJD3|SERC_SHESW Phosphoserine aminotransferase OS=Shewanella sp. (strain W3-18-1) GN=serC PE=3 SV=1 5 425 3.0E-71
sp|Q8EEH2|SERC_SHEON Phosphoserine aminotransferase OS=Shewanella oneidensis (strain MR-1) GN=serC PE=3 SV=2 5 425 6.0E-71
sp|A8FVN8|SERC_SHESH Phosphoserine aminotransferase OS=Shewanella sediminis (strain HAW-EB3) GN=serC PE=3 SV=1 8 425 6.0E-71
sp|Q9HZ66|SERC_PSEAE Phosphoserine aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=serC PE=1 SV=1 10 424 7.0E-71
sp|P91856|SERC_CAEEL Probable phosphoserine aminotransferase OS=Caenorhabditis elegans GN=F26H9.5 PE=3 SV=1 10 424 8.0E-71
sp|Q9SHP0|SERB2_ARATH Phosphoserine aminotransferase 2, chloroplastic OS=Arabidopsis thaliana GN=PSAT2 PE=1 SV=1 3 424 9.0E-71
sp|A3M7Z0|SERC_ACIBT Phosphoserine aminotransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=serC PE=3 SV=2 10 425 1.0E-70
sp|B7I5D6|SERC_ACIB5 Phosphoserine aminotransferase OS=Acinetobacter baumannii (strain AB0057) GN=serC PE=3 SV=1 10 425 1.0E-70
sp|B7GY87|SERC_ACIB3 Phosphoserine aminotransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=serC PE=3 SV=1 10 425 1.0E-70
sp|A6WNN5|SERC_SHEB8 Phosphoserine aminotransferase OS=Shewanella baltica (strain OS185) GN=serC PE=3 SV=1 5 425 2.0E-70
sp|A4Y757|SERC_SHEPC Phosphoserine aminotransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=serC PE=3 SV=1 5 425 2.0E-70
sp|Q02PX3|SERC_PSEAB Phosphoserine aminotransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=serC PE=3 SV=1 10 424 4.0E-70
sp|B7V9J9|SERC_PSEA8 Phosphoserine aminotransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=serC PE=3 SV=1 10 424 4.0E-70
sp|Q9KDM4|SERC_BACHD Phosphoserine aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=serC PE=3 SV=1 10 427 5.0E-70
sp|B2HWW3|SERC_ACIBC Phosphoserine aminotransferase OS=Acinetobacter baumannii (strain ACICU) GN=serC PE=3 SV=1 10 425 6.0E-70
sp|A3D4A1|SERC_SHEB5 Phosphoserine aminotransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=serC PE=3 SV=1 5 425 7.0E-70
sp|A1KV48|SERC_NEIMF Phosphoserine aminotransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=serC PE=3 SV=1 7 424 1.0E-69
sp|Q3SK88|SERC_THIDA Phosphoserine aminotransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=serC PE=3 SV=1 7 424 1.0E-69
sp|Q6D400|SERC_PECAS Phosphoserine aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=serC PE=3 SV=1 5 425 1.0E-69
sp|Q6F961|SERC_ACIAD Phosphoserine aminotransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=serC PE=3 SV=2 10 424 1.0E-69
sp|A9L2Y2|SERC_SHEB9 Phosphoserine aminotransferase OS=Shewanella baltica (strain OS195) GN=serC PE=3 SV=1 5 425 1.0E-69
sp|A9IJI3|SERC_BORPD Phosphoserine aminotransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=serC PE=3 SV=1 10 424 1.0E-69
sp|P80862|SERC_BACSU Phosphoserine aminotransferase OS=Bacillus subtilis (strain 168) GN=serC PE=1 SV=2 8 424 2.0E-69
sp|P81435|SERC_BUCAP Phosphoserine aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=serC PE=3 SV=1 7 424 2.0E-69
sp|B8EA90|SERC_SHEB2 Phosphoserine aminotransferase OS=Shewanella baltica (strain OS223) GN=serC PE=3 SV=1 5 425 2.0E-69
sp|A6V2Q8|SERC_PSEA7 Phosphoserine aminotransferase OS=Pseudomonas aeruginosa (strain PA7) GN=serC PE=3 SV=1 10 424 2.0E-69
sp|Q926T3|SERC_LISIN Phosphoserine aminotransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=serC PE=3 SV=1 10 425 4.0E-69
sp|Q5E6F2|SERC_VIBF1 Phosphoserine aminotransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=serC PE=3 SV=1 10 424 4.0E-69
sp|Q5F7A0|SERC_NEIG1 Phosphoserine aminotransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=serC PE=3 SV=1 7 424 5.0E-69
sp|P57007|SERC_NEIMB Phosphoserine aminotransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=serC PE=3 SV=1 7 424 6.0E-69
sp|B1KF45|SERC_SHEWM Phosphoserine aminotransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=serC PE=3 SV=1 8 425 8.0E-69
sp|Q8Y3L0|SERC_LISMO Phosphoserine aminotransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=serC PE=3 SV=1 10 425 9.0E-69
sp|Q71VT6|SERC_LISMF Phosphoserine aminotransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=serC PE=3 SV=1 10 425 1.0E-68
sp|A9BM04|SERC_DELAS Phosphoserine aminotransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=serC PE=3 SV=1 10 424 1.0E-68
sp|O34370|SERC_NEIMA Phosphoserine aminotransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=serC PE=3 SV=2 7 424 1.0E-68
sp|Q21Y51|SERC_RHOFT Phosphoserine aminotransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=serC PE=3 SV=1 10 424 1.0E-68
sp|B5FCJ8|SERC_VIBFM Phosphoserine aminotransferase OS=Vibrio fischeri (strain MJ11) GN=serC PE=3 SV=1 10 424 1.0E-68
sp|Q7NVP1|SERC_CHRVO Phosphoserine aminotransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=serC PE=3 SV=1 5 425 2.0E-68
sp|Q6ALW3|SERC_DESPS Phosphoserine aminotransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=serC PE=3 SV=1 10 425 2.0E-68
sp|A4G865|SERC_HERAR Phosphoserine aminotransferase OS=Herminiimonas arsenicoxydans GN=serC PE=3 SV=1 10 424 2.0E-68
sp|Q12CL3|SERC_POLSJ Phosphoserine aminotransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=serC PE=3 SV=1 10 424 3.0E-68
sp|A7MES8|SERC_CROS8 Phosphoserine aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=serC PE=3 SV=1 5 424 3.0E-68
sp|Q2SCF2|SERC_HAHCH Phosphoserine aminotransferase OS=Hahella chejuensis (strain KCTC 2396) GN=serC PE=3 SV=1 10 425 8.0E-68
sp|C6DF64|SERC_PECCP Phosphoserine aminotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=serC PE=3 SV=1 5 425 8.0E-68
sp|Q5P7U7|SERC_AROAE Phosphoserine aminotransferase OS=Aromatoleum aromaticum (strain EbN1) GN=serC PE=3 SV=1 5 425 1.0E-67
sp|Q081U0|SERC_SHEFN Phosphoserine aminotransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=serC PE=3 SV=1 5 426 2.0E-67
sp|Q96255|SERB1_ARATH Phosphoserine aminotransferase 1, chloroplastic OS=Arabidopsis thaliana GN=PSAT1 PE=1 SV=1 3 424 2.0E-67
sp|Q9RME2|SERC_BACAO Phosphoserine aminotransferase OS=Bacillus alcalophilus GN=serC PE=1 SV=1 6 424 3.0E-67
sp|A1VR16|SERC_POLNA Phosphoserine aminotransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=serC PE=3 SV=1 10 424 3.0E-67
sp|Q6LPD9|SERC_PHOPR Phosphoserine aminotransferase OS=Photobacterium profundum GN=serC PE=3 SV=1 6 424 3.0E-67
sp|Q87QA3|SERC_VIBPA Phosphoserine aminotransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=serC PE=3 SV=1 10 424 4.0E-67
sp|Q4ZQ94|SERC_PSEU2 Phosphoserine aminotransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=serC PE=3 SV=1 10 424 6.0E-67
sp|B8FLC3|SERC_DESAA Phosphoserine aminotransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=serC PE=3 SV=1 4 424 1.0E-66
sp|Q885T5|SERC_PSESM Phosphoserine aminotransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=serC PE=3 SV=1 10 424 1.0E-66
sp|Q5WHT9|SERC_BACSK Phosphoserine aminotransferase OS=Bacillus clausii (strain KSM-K16) GN=serC PE=3 SV=1 5 424 2.0E-66
sp|A9B6Q3|SERC_HERA2 Phosphoserine aminotransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=serC PE=3 SV=1 10 425 3.0E-66
sp|Q2L2T1|SERC_BORA1 Phosphoserine aminotransferase OS=Bordetella avium (strain 197N) GN=serC PE=3 SV=1 10 424 3.0E-66
sp|P52877|SERC_SPIOL Phosphoserine aminotransferase, chloroplastic OS=Spinacia oleracea PE=2 SV=1 3 424 3.0E-66
sp|Q7VR40|SERC_BLOFL Phosphoserine aminotransferase OS=Blochmannia floridanus GN=serC PE=3 SV=1 6 425 3.0E-66
sp|Q3ILA3|SERC_PSEHT Phosphoserine aminotransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=serC PE=3 SV=1 10 425 4.0E-66
sp|Q7W5Z9|SERC_BORPA Phosphoserine aminotransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=serC PE=3 SV=1 10 424 4.0E-66
sp|Q7WGU2|SERC_BORBR Phosphoserine aminotransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=serC PE=3 SV=1 10 424 4.0E-66
sp|P57881|SERC_PASMU Phosphoserine aminotransferase OS=Pasteurella multocida (strain Pm70) GN=serC PE=3 SV=1 5 424 5.0E-66
sp|B5EPR5|SERC_ACIF5 Phosphoserine aminotransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=serC PE=3 SV=1 7 425 5.0E-66
sp|B7J6V1|SERC_ACIF2 Phosphoserine aminotransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=serC PE=3 SV=1 7 425 5.0E-66
sp|A1AWS0|SERC_RUTMC Phosphoserine aminotransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=serC PE=3 SV=1 5 424 6.0E-66
sp|Q8F930|SERC_LEPIN Phosphoserine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=serC PE=3 SV=2 4 424 7.0E-66
sp|Q72VI2|SERC_LEPIC Phosphoserine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=serC PE=3 SV=2 4 424 7.0E-66
sp|Q1RDV1|SERC_ECOUT Phosphoserine aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=serC PE=3 SV=1 5 424 1.0E-65
sp|A1A9I4|SERC_ECOK1 Phosphoserine aminotransferase OS=Escherichia coli O1:K1 / APEC GN=serC PE=3 SV=1 5 424 1.0E-65
sp|B7MHL6|SERC_ECO45 Phosphoserine aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=serC PE=3 SV=1 5 424 1.0E-65
sp|Q7VZG4|SERC_BORPE Phosphoserine aminotransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=serC PE=3 SV=1 10 424 1.0E-65
sp|Q1IDA2|SERC_PSEE4 Phosphoserine aminotransferase OS=Pseudomonas entomophila (strain L48) GN=serC PE=3 SV=1 10 424 2.0E-65
sp|Q7MLH6|SERC_VIBVY Phosphoserine aminotransferase OS=Vibrio vulnificus (strain YJ016) GN=serC PE=3 SV=2 10 424 3.0E-65
sp|Q8D900|SERC_VIBVU Phosphoserine aminotransferase OS=Vibrio vulnificus (strain CMCP6) GN=serC PE=3 SV=1 10 424 3.0E-65
sp|A9A0A5|SERC_DESOH Phosphoserine aminotransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=serC PE=3 SV=1 6 427 4.0E-65
sp|B7UMZ3|SERC_ECO27 Phosphoserine aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=serC PE=3 SV=1 5 424 4.0E-65
sp|Q9RI02|SERC_PSEST Phosphoserine aminotransferase OS=Pseudomonas stutzeri GN=serC PE=3 SV=2 10 424 5.0E-65
sp|Q8FJB7|SERC_ECOL6 Phosphoserine aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=serC PE=3 SV=3 5 424 5.0E-65
sp|Q0TJE6|SERC_ECOL5 Phosphoserine aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=serC PE=3 SV=1 5 424 5.0E-65
sp|B7MS22|SERC_ECO81 Phosphoserine aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=serC PE=3 SV=1 5 424 5.0E-65
sp|C1DRQ9|SERC_AZOVD Phosphoserine aminotransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=serC PE=3 SV=1 10 424 5.0E-65
sp|B0SKW4|SERC_LEPBP Phosphoserine aminotransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=serC PE=3 SV=1 1 424 9.0E-65
sp|B0SCE2|SERC_LEPBA Phosphoserine aminotransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=serC PE=3 SV=1 1 424 9.0E-65
sp|C3K6J5|SERC_PSEFS Phosphoserine aminotransferase OS=Pseudomonas fluorescens (strain SBW25) GN=serC PE=3 SV=1 10 424 1.0E-64
sp|Q2NUB0|SERC_SODGM Phosphoserine aminotransferase OS=Sodalis glossinidius (strain morsitans) GN=serC PE=3 SV=1 5 425 2.0E-64
sp|B7NM68|SERC_ECO7I Phosphoserine aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=serC PE=3 SV=1 5 424 2.0E-64
sp|B7LN70|SERC_ESCF3 Phosphoserine aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=serC PE=3 SV=1 5 424 3.0E-64
sp|Q81BC0|SERC_BACCR Phosphoserine aminotransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=serC PE=3 SV=1 10 426 3.0E-64
sp|Q5L296|SERC_GEOKA Phosphoserine aminotransferase OS=Geobacillus kaustophilus (strain HTA426) GN=serC PE=3 SV=1 10 424 3.0E-64
sp|Q88M07|SERC_PSEPK Phosphoserine aminotransferase OS=Pseudomonas putida (strain KT2440) GN=serC PE=3 SV=1 10 424 5.0E-64
sp|C3P210|SERC_BACAA Phosphoserine aminotransferase OS=Bacillus anthracis (strain A0248) GN=serC PE=3 SV=1 10 426 6.0E-64
sp|A7ZJZ6|SERC_ECO24 Phosphoserine aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|P19689|SERC_YERE8 Phosphoserine aminotransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=serC PE=3 SV=2 5 424 1.0E-63
sp|Q9X4H1|SERC_EDWI9 Phosphoserine aminotransferase OS=Edwardsiella ictaluri (strain 93-146) GN=serC PE=3 SV=2 5 425 1.0E-63
sp|A9MHX6|SERC_SALAR Phosphoserine aminotransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|Q3Z3L5|SERC_SHISS Phosphoserine aminotransferase OS=Shigella sonnei (strain Ss046) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|Q83LP3|SERC_SHIFL Phosphoserine aminotransferase OS=Shigella flexneri GN=serC PE=3 SV=1 5 424 1.0E-63
sp|B1LJV7|SERC_ECOSM Phosphoserine aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|B6I8X9|SERC_ECOSE Phosphoserine aminotransferase OS=Escherichia coli (strain SE11) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|B1IW24|SERC_ECOLC Phosphoserine aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|A7ZYL0|SERC_ECOHS Phosphoserine aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|B7M835|SERC_ECO8A Phosphoserine aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|B7LD99|SERC_ECO55 Phosphoserine aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|B5YT41|SERC_ECO5E Phosphoserine aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|Q8XEA7|SERC_ECO57 Phosphoserine aminotransferase OS=Escherichia coli O157:H7 GN=serC PE=3 SV=3 5 424 1.0E-63
sp|B5XY88|SERC_KLEP3 Phosphoserine aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|Q492S5|SERC_BLOPB Phosphoserine aminotransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=serC PE=3 SV=1 5 425 1.0E-63
sp|B7NAQ6|SERC_ECOLU Phosphoserine aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=serC PE=3 SV=1 5 424 1.0E-63
sp|Q31YU4|SERC_SHIBS Phosphoserine aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=serC PE=3 SV=1 5 424 2.0E-63
sp|Q32E24|SERC_SHIDS Phosphoserine aminotransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=serC PE=3 SV=1 5 424 2.0E-63
sp|B2TUH4|SERC_SHIB3 Phosphoserine aminotransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=serC PE=3 SV=1 5 424 2.0E-63
sp|Q0I322|SERC_HAES1 Phosphoserine aminotransferase OS=Haemophilus somnus (strain 129Pt) GN=serC PE=3 SV=1 6 424 3.0E-63
sp|B2FKF0|SERC_STRMK Phosphoserine aminotransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=serC PE=3 SV=1 10 424 3.0E-63
sp|A4W8S7|SERC_ENT38 Phosphoserine aminotransferase OS=Enterobacter sp. (strain 638) GN=serC PE=3 SV=1 5 424 5.0E-63
sp|Q734W9|SERC_BACC1 Phosphoserine aminotransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=serC PE=3 SV=1 10 426 8.0E-63
sp|A6T700|SERC_KLEP7 Phosphoserine aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=serC PE=3 SV=1 5 424 8.0E-63
sp|P23721|SERC_ECOLI Phosphoserine aminotransferase OS=Escherichia coli (strain K12) GN=serC PE=1 SV=4 5 424 8.0E-63
sp|B1X847|SERC_ECODH Phosphoserine aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=serC PE=3 SV=1 5 424 8.0E-63
sp|C4ZQ33|SERC_ECOBW Phosphoserine aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=serC PE=3 SV=1 5 424 8.0E-63
sp|Q8DSV3|SERC_STRMU Phosphoserine aminotransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=serC PE=3 SV=1 7 424 2.0E-62
sp|Q6HGI0|SERC_BACHK Phosphoserine aminotransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=serC PE=3 SV=1 10 426 2.0E-62
sp|B2VC80|SERC_ERWT9 Phosphoserine aminotransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=serC PE=3 SV=1 5 424 2.0E-62
sp|A5CWI0|SERC_VESOH Phosphoserine aminotransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=serC PE=3 SV=1 5 424 3.0E-62
sp|B4SP45|SERC_STRM5 Phosphoserine aminotransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=serC PE=3 SV=1 10 424 3.0E-62
sp|B1JRE0|SERC_YERPY Phosphoserine aminotransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=serC PE=3 SV=1 5 424 5.0E-62
sp|A7FJX0|SERC_YERP3 Phosphoserine aminotransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=serC PE=3 SV=1 5 424 5.0E-62
sp|Q638W1|SERC_BACCZ Phosphoserine aminotransferase OS=Bacillus cereus (strain ZK / E33L) GN=serC PE=3 SV=1 10 426 1.0E-61
sp|Q66CI9|SERC_YERPS Phosphoserine aminotransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=serC PE=3 SV=1 5 424 1.0E-61
sp|B2KA22|SERC_YERPB Phosphoserine aminotransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=serC PE=3 SV=1 5 424 1.0E-61
sp|Q9KSU7|SERC_VIBCH Phosphoserine aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=serC PE=3 SV=2 1 424 1.0E-61
sp|Q057N5|SERC_BUCCC Phosphoserine aminotransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=serC PE=3 SV=1 5 424 1.0E-61
sp|P62677|SERC_SALTI Phosphoserine aminotransferase OS=Salmonella typhi GN=serC PE=3 SV=1 5 424 2.0E-61
sp|B4TRT8|SERC_SALSV Phosphoserine aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|A9N7V7|SERC_SALPB Phosphoserine aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|B4TD37|SERC_SALHS Phosphoserine aminotransferase OS=Salmonella heidelberg (strain SL476) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|P62676|SERC_SALGL Phosphoserine aminotransferase OS=Salmonella gallinarum GN=serC PE=3 SV=1 5 424 2.0E-61
sp|B5R8J4|SERC_SALG2 Phosphoserine aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|B5QYQ7|SERC_SALEP Phosphoserine aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|B5FQ49|SERC_SALDC Phosphoserine aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|B5F159|SERC_SALA4 Phosphoserine aminotransferase OS=Salmonella agona (strain SL483) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|A4TN19|SERC_YERPP Phosphoserine aminotransferase OS=Yersinia pestis (strain Pestoides F) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|Q9CHW5|SERC_LACLA Phosphoserine aminotransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=serC PE=3 SV=1 7 424 2.0E-61
sp|A9R7I1|SERC_YERPG Phosphoserine aminotransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|Q8ZGB4|SERC_YERPE Phosphoserine aminotransferase OS=Yersinia pestis GN=serC PE=3 SV=1 5 424 2.0E-61
sp|Q1CA74|SERC_YERPA Phosphoserine aminotransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=serC PE=3 SV=1 5 424 2.0E-61
sp|P55900|SERC_SALTY Phosphoserine aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=serC PE=1 SV=2 5 424 3.0E-61
sp|B4T141|SERC_SALNS Phosphoserine aminotransferase OS=Salmonella newport (strain SL254) GN=serC PE=3 SV=1 5 424 3.0E-61
sp|Q7N6D6|SERC_PHOLL Phosphoserine aminotransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=serC PE=3 SV=1 5 424 3.0E-61
sp|C0PXU3|SERC_SALPC Phosphoserine aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=serC PE=3 SV=1 5 424 4.0E-61
sp|Q57R24|SERC_SALCH Phosphoserine aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=serC PE=3 SV=1 5 424 4.0E-61
sp|A8AIH6|SERC_CITK8 Phosphoserine aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=serC PE=3 SV=1 5 424 4.0E-61
sp|A3CPJ2|SERC_STRSV Phosphoserine aminotransferase OS=Streptococcus sanguinis (strain SK36) GN=serC PE=3 SV=1 7 424 6.0E-61
sp|B4ET24|SERC_PROMH Phosphoserine aminotransferase OS=Proteus mirabilis (strain HI4320) GN=serC PE=3 SV=1 5 424 8.0E-61
sp|Q8D268|SERC_WIGBR Phosphoserine aminotransferase OS=Wigglesworthia glossinidia brevipalpis GN=serC PE=3 SV=1 6 424 1.0E-60
sp|Q1D2L9|SERC_MYXXD Phosphoserine aminotransferase OS=Myxococcus xanthus (strain DK 1622) GN=serC PE=3 SV=1 6 427 2.0E-60
sp|A4VU42|SERC_STRSY Phosphoserine aminotransferase OS=Streptococcus suis (strain 05ZYH33) GN=serC PE=3 SV=1 7 426 3.0E-60
sp|A4W0D4|SERC_STRS2 Phosphoserine aminotransferase OS=Streptococcus suis (strain 98HAH33) GN=serC PE=3 SV=1 7 426 3.0E-60
sp|A2RIS2|SERC_LACLM Phosphoserine aminotransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=serC PE=3 SV=1 7 424 6.0E-60
sp|C4K3B1|SERC_HAMD5 Phosphoserine aminotransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=serC PE=3 SV=1 7 425 9.0E-60
sp|A8GCH0|SERC_SERP5 Phosphoserine aminotransferase OS=Serratia proteamaculans (strain 568) GN=serC PE=3 SV=1 5 424 9.0E-60
sp|P59492|SERC_BUCBP Phosphoserine aminotransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=serC PE=3 SV=1 1 424 1.0E-59
sp|Q031D5|SERC_LACLS Phosphoserine aminotransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=serC PE=3 SV=1 7 424 1.0E-59
sp|Q7UQL3|SERC_RHOBA Phosphoserine aminotransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=serC PE=3 SV=2 10 425 4.0E-59
sp|A5IBR0|SERC_LEGPC Phosphoserine aminotransferase OS=Legionella pneumophila (strain Corby) GN=serC PE=3 SV=1 5 425 7.0E-59
sp|Q03JH6|SERC_STRTD Phosphoserine aminotransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=serC PE=3 SV=1 7 424 2.0E-58
sp|Q5LYP0|SERC_STRT1 Phosphoserine aminotransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=serC PE=3 SV=1 7 424 2.0E-58
sp|Q7VLP0|SERC_HAEDU Phosphoserine aminotransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=serC PE=3 SV=1 10 425 2.0E-58
sp|Q8RLW0|SERC_XENNA Phosphoserine aminotransferase OS=Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6) GN=serC PE=3 SV=1 5 424 2.0E-58
sp|Q65S80|SERC_MANSM Phosphoserine aminotransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=serC PE=3 SV=1 5 424 5.0E-58
sp|Q5ZVM2|SERC_LEGPH Phosphoserine aminotransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=serC PE=3 SV=2 5 425 5.0E-58
sp|P44336|SERC_HAEIN Phosphoserine aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=serC PE=3 SV=1 5 424 9.0E-58
sp|B6J1E0|SERC_COXB2 Phosphoserine aminotransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=serC PE=3 SV=1 5 424 1.0E-57
sp|B6J893|SERC_COXB1 Phosphoserine aminotransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=serC PE=3 SV=1 5 424 1.0E-57
sp|Q5WWT0|SERC_LEGPL Phosphoserine aminotransferase OS=Legionella pneumophila (strain Lens) GN=serC PE=3 SV=1 5 425 1.0E-57
sp|A0LK14|SERC_SYNFM Phosphoserine aminotransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=serC PE=3 SV=1 6 424 1.0E-57
sp|Q5M3A4|SERC_STRT2 Phosphoserine aminotransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=serC PE=3 SV=1 7 424 1.0E-57
sp|Q9PB19|SERC_XYLFA Phosphoserine aminotransferase OS=Xylella fastidiosa (strain 9a5c) GN=serC PE=3 SV=1 6 424 1.0E-57
sp|A9KCT6|SERC_COXBN Phosphoserine aminotransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=serC PE=3 SV=1 5 424 1.0E-57
sp|Q83E12|SERC_COXBU Phosphoserine aminotransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=serC PE=3 SV=1 5 424 1.0E-57
sp|A9NC17|SERC_COXBR Phosphoserine aminotransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=serC PE=3 SV=1 5 424 3.0E-57
sp|Q5X5E7|SERC_LEGPA Phosphoserine aminotransferase OS=Legionella pneumophila (strain Paris) GN=serC PE=3 SV=1 5 425 3.0E-57
sp|Q87BU0|SERC_XYLFT Phosphoserine aminotransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=serC PE=3 SV=1 6 424 1.0E-56
sp|B2SJJ1|SERC_XANOP Phosphoserine aminotransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=serC PE=3 SV=1 10 424 1.0E-56
sp|Q5H079|SERC_XANOR Phosphoserine aminotransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=serC PE=3 SV=1 10 424 1.0E-56
sp|Q2P354|SERC_XANOM Phosphoserine aminotransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=serC PE=3 SV=1 10 424 1.0E-56
sp|Q1LTL2|SERC_BAUCH Phosphoserine aminotransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=serC PE=3 SV=1 10 425 2.0E-56
sp|A8YW78|SERC_LACH4 Phosphoserine aminotransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=serC PE=3 SV=1 10 424 2.0E-56
sp|Q3BUZ3|SERC_XANC5 Phosphoserine aminotransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=serC PE=3 SV=1 10 424 7.0E-56
sp|B9DTW4|SERC_STRU0 Phosphoserine aminotransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=serC PE=3 SV=1 7 424 8.0E-56
sp|B8D7K4|SERC_BUCAT Phosphoserine aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=serC PE=3 SV=1 7 424 1.0E-55
sp|P57397|SERC_BUCAI Phosphoserine aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=serC PE=3 SV=1 7 424 2.0E-55
sp|B8D9A2|SERC_BUCA5 Phosphoserine aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=serC PE=3 SV=1 7 424 2.0E-55
sp|Q8E3Y3|SERC_STRA3 Phosphoserine aminotransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=serC PE=3 SV=1 7 424 2.0E-55
sp|Q8PLY7|SERC_XANAC Phosphoserine aminotransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=serC PE=3 SV=1 10 424 7.0E-55
sp|B0RUW3|SERC_XANCB Phosphoserine aminotransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=serC PE=3 SV=1 10 424 1.0E-53
sp|Q88ZU5|SERC_LACPL Phosphoserine aminotransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=serC PE=3 SV=1 7 424 1.0E-53
sp|Q8PA97|SERC_XANCP Phosphoserine aminotransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=serC PE=3 SV=1 10 424 3.0E-53
sp|Q4UTC9|SERC_XANC8 Phosphoserine aminotransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=serC PE=3 SV=1 10 424 3.0E-53
sp|B9KDM7|SERC_CAMLR Phosphoserine aminotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=serC PE=3 SV=1 10 425 5.0E-52
sp|Q9PIH3|SERC_CAMJE Phosphoserine aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=serC PE=1 SV=1 10 424 5.0E-52
sp|A8FKB5|SERC_CAMJ8 Phosphoserine aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=serC PE=3 SV=1 10 424 1.0E-51
sp|A7H543|SERC_CAMJD Phosphoserine aminotransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=serC PE=3 SV=1 10 424 5.0E-51
sp|A1VY45|SERC_CAMJJ Phosphoserine aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=serC PE=3 SV=1 10 424 1.0E-50
sp|Q64UR4|SERC_BACFR Phosphoserine aminotransferase OS=Bacteroides fragilis (strain YCH46) GN=serC PE=3 SV=1 10 424 1.0E-50
sp|Q5LDN9|SERC_BACFN Phosphoserine aminotransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=serC PE=3 SV=1 10 424 1.0E-50
sp|Q5HWE5|SERC_CAMJR Phosphoserine aminotransferase OS=Campylobacter jejuni (strain RM1221) GN=serC PE=3 SV=1 10 424 4.0E-50
sp|B6YQL2|SERC_AZOPC Phosphoserine aminotransferase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=serC PE=3 SV=1 10 424 3.0E-49
sp|C4L432|SERC_EXISA Phosphoserine aminotransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=serC PE=3 SV=1 10 424 8.0E-49
sp|B2GBS2|SERC_LACF3 Phosphoserine aminotransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=serC PE=3 SV=1 10 424 9.0E-49
sp|A5EV80|SERC_DICNV Phosphoserine aminotransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=serC PE=3 SV=1 10 425 1.0E-48
sp|Q8A8L4|SERC_BACTN Phosphoserine aminotransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=serC PE=3 SV=1 10 424 5.0E-48
sp|A6L5A6|SERC_BACV8 Phosphoserine aminotransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=serC PE=3 SV=1 10 424 1.0E-47
sp|Q7MV30|SERC_PORGI Phosphoserine aminotransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=serC PE=3 SV=1 10 424 7.0E-46
sp|B2RID6|SERC_PORG3 Phosphoserine aminotransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=serC PE=3 SV=1 10 424 7.0E-46
sp|A6L9B7|SERC_PARD8 Phosphoserine aminotransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=serC PE=3 SV=1 10 424 7.0E-45
sp|A6GXC2|SERC_FLAPJ Phosphoserine aminotransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=serC PE=3 SV=1 10 422 1.0E-43
sp|Q03W65|SERC_LEUMM Phosphoserine aminotransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=serC PE=3 SV=1 10 422 3.0E-43
sp|A5FH28|SERC_FLAJ1 Phosphoserine aminotransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=serC PE=3 SV=1 10 424 2.0E-42
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2392
MPSRSEITYFGAGPALLPTDVLEKAAKALLDYNETGLGVAEHSHRSQLATDIINQAKADLANCLDIPDDYEILFM
QGGGTGQFSAAVYNFAGAWVARKCKEIFGDIQGDPADHPELLKTLKQAVENDLKMDYLVTGGWSQKASAEGERLL
GSKHVNIAADARKTNGGKFGTIPDESSWKLSKDAAFVYFCSNETVDGVEFPALPESLEPGPDGKGPIVVADMSSN
ILTRKIPVEKFSAIFFGAQKNLGVTGITVVIIRKSFLPPVLSQPSTTLMRHLGLPVPPIIFQYETIAKNNSLYNT
LSIFDVYVAGQVLKKLLQTYPNKVEGQEAVTDKKAQLIYDAIEAFPDIYKVIPDKAARSRINICFRVTKDGDIDA
SEKAFLQEGVAQGLTGLKGHRSMGGIRASNYNSVPLEGAEKLAKFIRTFAMT*
Coding >OphauB2|2392
ATGCCCTCGAGATCTGAAATCACCTATTTTGGTGCAGGTCCAGCCCTGCTACCTACTGATGTCCTCGAGAAAGCT
GCCAAGGCTCTTCTTGATTATAATGAAACTGGCCTAGGCGTCGCTGAACATTCTCACCGTTCGCAGCTAGCAACC
GATATCATAAATCAAGCCAAAGCTGACCTCGCCAACTGTCTTGATATTCCAGACGACTATGAGATTCTCTTCATG
CAAGGCGGTGGCACAGGACAATTCTCTGCCGCTGTATATAACTTTGCTGGCGCCTGGGTTGCCCGCAAGTGCAAA
GAGATCTTTGGTGATATCCAAGGCGATCCCGCCGATCACCCTGAGTTGTTGAAAACACTCAAACAAGCCGTGGAG
AATGATCTCAAGATGGATTACCTTGTTACCGGCGGCTGGTCACAGAAAGCATCAGCTGAAGGCGAGCGTCTGCTG
GGCTCCAAGCACGTCAACATTGCGGCGGATGCCCGAAAGACAAACGGCGGCAAGTTTGGAACAATTCCGGATGAG
AGCAGCTGGAAACTATCCAAAGATGCAGCCTTTGTCTACTTTTGCTCCAACGAGACGGTCGACGGAGTTGAATTT
CCTGCACTTCCCGAGTCTCTTGAGCCGGGGCCTGATGGAAAGGGCCCAATTGTTGTTGCCGATATGAGTTCGAAT
ATCCTTACAAGAAAGATTCCAGTGGAAAAATTTTCAGCAATCTTCTTTGGAGCCCAGAAGAATCTTGGAGTGACT
GGTATTACCGTCGTTATCATCAGGAAGAGCTTCCTCCCCCCTGTATTATCTCAGCCTTCCACGACCTTGATGAGG
CATCTTGGTTTACCGGTGCCCCCCATCATTTTCCAGTATGAGACCATTGCCAAGAACAACAGCCTTTATAATACA
CTGAGTATTTTTGATGTATACGTTGCGGGCCAAGTTCTCAAGAAGCTATTACAGACCTATCCCAACAAGGTTGAA
GGCCAAGAAGCTGTAACTGACAAAAAGGCTCAACTGATTTATGATGCGATTGAGGCTTTTCCTGACATCTACAAA
GTCATCCCTGATAAAGCAGCACGGTCGCGTATCAATATTTGCTTCAGAGTTACCAAAGATGGCGATATTGATGCC
TCCGAAAAAGCCTTTTTACAGGAGGGTGTAGCCCAGGGGCTGACTGGGCTCAAGGGACATCGTTCCATGGGCGGA
ATTCGAGCAAGCAACTACAATTCTGTTCCTCTTGAAGGTGCAGAGAAGCTTGCCAAATTCATCCGCACTTTCGCA
ATGACATAG
Transcript >OphauB2|2392
ATGCCCTCGAGATCTGAAATCACCTATTTTGGTGCAGGTCCAGCCCTGCTACCTACTGATGTCCTCGAGAAAGCT
GCCAAGGCTCTTCTTGATTATAATGAAACTGGCCTAGGCGTCGCTGAACATTCTCACCGTTCGCAGCTAGCAACC
GATATCATAAATCAAGCCAAAGCTGACCTCGCCAACTGTCTTGATATTCCAGACGACTATGAGATTCTCTTCATG
CAAGGCGGTGGCACAGGACAATTCTCTGCCGCTGTATATAACTTTGCTGGCGCCTGGGTTGCCCGCAAGTGCAAA
GAGATCTTTGGTGATATCCAAGGCGATCCCGCCGATCACCCTGAGTTGTTGAAAACACTCAAACAAGCCGTGGAG
AATGATCTCAAGATGGATTACCTTGTTACCGGCGGCTGGTCACAGAAAGCATCAGCTGAAGGCGAGCGTCTGCTG
GGCTCCAAGCACGTCAACATTGCGGCGGATGCCCGAAAGACAAACGGCGGCAAGTTTGGAACAATTCCGGATGAG
AGCAGCTGGAAACTATCCAAAGATGCAGCCTTTGTCTACTTTTGCTCCAACGAGACGGTCGACGGAGTTGAATTT
CCTGCACTTCCCGAGTCTCTTGAGCCGGGGCCTGATGGAAAGGGCCCAATTGTTGTTGCCGATATGAGTTCGAAT
ATCCTTACAAGAAAGATTCCAGTGGAAAAATTTTCAGCAATCTTCTTTGGAGCCCAGAAGAATCTTGGAGTGACT
GGTATTACCGTCGTTATCATCAGGAAGAGCTTCCTCCCCCCTGTATTATCTCAGCCTTCCACGACCTTGATGAGG
CATCTTGGTTTACCGGTGCCCCCCATCATTTTCCAGTATGAGACCATTGCCAAGAACAACAGCCTTTATAATACA
CTGAGTATTTTTGATGTATACGTTGCGGGCCAAGTTCTCAAGAAGCTATTACAGACCTATCCCAACAAGGTTGAA
GGCCAAGAAGCTGTAACTGACAAAAAGGCTCAACTGATTTATGATGCGATTGAGGCTTTTCCTGACATCTACAAA
GTCATCCCTGATAAAGCAGCACGGTCGCGTATCAATATTTGCTTCAGAGTTACCAAAGATGGCGATATTGATGCC
TCCGAAAAAGCCTTTTTACAGGAGGGTGTAGCCCAGGGGCTGACTGGGCTCAAGGGACATCGTTCCATGGGCGGA
ATTCGAGCAAGCAACTACAATTCTGTTCCTCTTGAAGGTGCAGAGAAGCTTGCCAAATTCATCCGCACTTTCGCA
ATGACATAG
Gene >OphauB2|2392
ATGCCCTCGAGATCTGAAATCACCTATTTTGGTGCAGGTCCAGCCCTGCTACCTACTGATGTCCTCGAGAAAGCT
GCCAAGGCTCTTCTTGATTATAATGAAACTGGCCTAGGCGGTATGGAGCTCCCATATTGCTTCGTTCCCTCTTTT
AGCATATTCCCACGACTCATCTTGGTCTATTTCCCAGCTGCTACGAATGAGTCATGCTGACCTTTGGGCTCTCCG
TGTAGTCGCTGAACATTCTCACCGTTCGCAGCTAGCAACCGATATCATAAATCAAGCCAAAGCTGACCTCGCCAA
CTGTCTTGATATTCCAGACGACTATGAGATTCTCTTCATGCAAGGCGGTGGCACAGTATGTGACTTTATCTATAC
TAGAGAAGCAATACTAAGCTCAAATCGTTAGGGACAATTCTCTGCCGCTGTATATAACTTTGCTGGCGCCTGGGT
TGCCCGCAAGTGCAAAGAGATCTTTGGTGATATCCAAGGCGATCCCGCCGATCACCCTGAGTTGTTGAAAACACT
CAAACAAGCCGTGGAGAATGATCTCAAGATGGATTACCTTGTTACCGGCGGCTGTATGATGACCAAATTCTACCC
TTTCTTGTACTCTTCTCGCAACCTAGCGCAGGTTCTAGATATCAAGAATAGCAAACTAACTTGCTCTACTTATAA
GGGTCACAGAAAGCATCAGCTGAAGGCGAGCGTCTGCTGGGCTCCAAGCACGTCAACATGTCAGTTAAAGATCCA
CCGCGCCTGTTTTGTCTCTCCCATCACCTATAAACAAATGGCATATTGAAGACATTATTTGGATGGGAGCCGAGA
TTAGTATACTGACTTATTGTTTCCCGTAAGTGCGGCGGATGCCCGAAAGACAAACGGCGGCAAGTTTGGAACAAT
TCCGGATGAGAGCAGCTGGAAACTATCCAAAGATGCAGCCTTTGTCTACTTTTGCTCCAACGAGACGGTCGACGG
AGTTGAATTTCCTGCACTTCCCGAGTCTCTTGAGCCGGGGCCTGATGGAAAGGGCCCAATTGTTGTTGCCGATAT
GAGTTCGAATATCCTTACAAGAAAGATTCCAGTGGAAAAATTTTCAGCAATCTTCTTTGGAGCCCAGAAGAATCT
TGGAGTGACTGGTATTACCGTCGTTATCATCAGGAAGAGCTTCCTCCCCCCTGTATTATCTCAGCCTTCCACGAC
CTTGATGAGGCATCTTGGTTTACCGGTGCCCCCCATCATTTTCCAGTATGAGACCATTGCCAAGAACAACAGCCT
TTATAATACACTGAGTATTTTTGAGTAAGTTAATTGCTCAGTCAAACAATCTTGGTTTGGACGAATGCTGACTAT
ATGGATAGTGTATACGTTGCGGGCCAAGTTCTCAAGAAGCTATTACAGACCTATCCCAACAAGGTTGAAGGCCAA
GAAGCTGTAACTGACAAAAAGGCTCAACTGATTTATGATGCGATTGAGGCTTTTCCTGACATCTACAAAGTCATC
CCTGATAAAGCAGCACGGTCGCGTATCAATATTTGCTTCAGAGTTACCAAAGATGGCGATATTGATGCCTCCGAA
AAAGCCTTTTTACAGGAGGGTGTAGCCCAGGGGCTGACTGGGCTCAAGGGACATCGTTCCATGGGCGGTATGTCA
TTTGCAGAGCGTTTCACAAACTTGTGATTTTTTTTTATTTTTTTTATTTTTTGTAATTTTATCCTGGATCCGAGT
ACTGACTTGGGAGTGTCGCATAGGAATTCGAGCAAGCAACTACAATTCTGTTCCTCTTGAAGGTGCAGAGAAGCT
TGCCAAATTCATCCGCACTTTCGCAATGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail