Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|239
Gene name
LocationContig_10:202290..203078
Strand+
Gene length (bp)788
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20238 DUF6595 Family of unknown function (DUF6595) 1.3E-27 16 151

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q4WCX9|YA280_ASPFU Uncharacterized protein AFUA_6G02800 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G02800 PE=1 SV=1 10 151 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|239
MKLLTLTTVFSSLALAHFEMTQPKSIGFSDDDEDKAPCGGFTPDFSKNVVDYPVGGAALAMRSTHQQSNWLFRGT
LDEKAEKGWKQMFPIVMQTGLGDFCEPSVPAPAQWAGKKGVVSIVSSATDGLLYQCIAVNFVNGTGEQPQECRNG
TAKASFTTDSRLTALVDNGSSSGGNTDASSTGGASSTRTASPQASGSQGAAASMQAPAFGSGILALIGAALLA*
Coding >OphauB2|239
ATGAAGCTGCTCACCCTCACCACCGTCTTCTCGTCGCTTGCGCTTGCGCACTTTGAGATGACACAACCCAAGTCT
ATTGGCTTCTCCGACGATGACGAGGACAAGGCACCGTGCGGAGGCTTCACGCCCGACTTTAGCAAAAACGTCGTT
GACTACCCAGTGGGCGGCGCTGCGCTGGCCATGCGCTCCACACATCAACAGAGCAACTGGCTATTCCGCGGCACG
CTCGACGAAAAGGCGGAAAAGGGCTGGAAGCAAATGTTTCCCATTGTCATGCAGACGGGACTAGGCGACTTTTGC
GAGCCCAGTGTTCCAGCGCCGGCCCAGTGGGCGGGCAAAAAGGGCGTTGTGAGCATCGTGTCTTCGGCCACTGAT
GGCTTGCTCTACCAGTGCATCGCCGTCAACTTTGTAAATGGCACCGGAGAGCAGCCCCAAGAGTGCCGAAATGGC
ACCGCCAAAGCCTCCTTCACCACCGACAGCCGTCTCACGGCCCTAGTCGACAACGGCAGCAGCTCTGGCGGCAAC
ACAGATGCAAGCTCCACTGGCGGAGCGTCATCGACGAGAACAGCGTCACCCCAGGCCTCAGGCTCACAGGGTGCA
GCAGCCTCCATGCAGGCGCCCGCCTTCGGAAGCGGAATCTTGGCCTTGATTGGAGCAGCTCTGTTGGCCTAG
Transcript >OphauB2|239
ATGAAGCTGCTCACCCTCACCACCGTCTTCTCGTCGCTTGCGCTTGCGCACTTTGAGATGACACAACCCAAGTCT
ATTGGCTTCTCCGACGATGACGAGGACAAGGCACCGTGCGGAGGCTTCACGCCCGACTTTAGCAAAAACGTCGTT
GACTACCCAGTGGGCGGCGCTGCGCTGGCCATGCGCTCCACACATCAACAGAGCAACTGGCTATTCCGCGGCACG
CTCGACGAAAAGGCGGAAAAGGGCTGGAAGCAAATGTTTCCCATTGTCATGCAGACGGGACTAGGCGACTTTTGC
GAGCCCAGTGTTCCAGCGCCGGCCCAGTGGGCGGGCAAAAAGGGCGTTGTGAGCATCGTGTCTTCGGCCACTGAT
GGCTTGCTCTACCAGTGCATCGCCGTCAACTTTGTAAATGGCACCGGAGAGCAGCCCCAAGAGTGCCGAAATGGC
ACCGCCAAAGCCTCCTTCACCACCGACAGCCGTCTCACGGCCCTAGTCGACAACGGCAGCAGCTCTGGCGGCAAC
ACAGATGCAAGCTCCACTGGCGGAGCGTCATCGACGAGAACAGCGTCACCCCAGGCCTCAGGCTCACAGGGTGCA
GCAGCCTCCATGCAGGCGCCCGCCTTCGGAAGCGGAATCTTGGCCTTGATTGGAGCAGCTCTGTTGGCCTAG
Gene >OphauB2|239
ATGAAGCTGCTCACCCTCACCACCGTCTTCTCGTCGCTTGCGCTTGCGCACTTTGAGATGACACAACCCAAGTCT
ATTGGCTTCTCCGACGATGACGAGGACAAGGCACCGTGCGGAGGCTTCACGCCCGACTTTAGCAAAAACGTCGTT
GACTACCCAGTGGGCGGCGCTGCGCTGGCCATGCGCTCCACACATCAACAGAGCAACTGGCTATTCCGCGGCACG
CTCGACGAAAAGGCGGAAAAGGGCTGGAAGCAAATGTTTCCCATTGTCATGCAGACGGGACTAGGCGACTTTTGC
GAGCCCAGTGTTCCAGCGCCGGCCCAGTGGGCGGGCAAAAAGGGCGTTGTGAGCATCGTGTCTTCGGCCACTGAT
GGCTTGCTCTACCAGGTATGTCGACTCTTGCACATTCTAATCCGCTTTATAAATGGGGCGCGCAAATGCCTCTTT
GTGCAAAGCCTTCCTCTGCAGCTTCTTGAAGCAGTCTAGGTGCTAATTCTTCCAAGTGCATCGCCGTCAACTTTG
TAAATGGCACCGGAGAGCAGCCCCAAGAGTGCCGAAATGGCACCGCCAAAGCCTCCTTCACCACCGACAGCCGTC
TCACGGCCCTAGTCGACAACGGCAGCAGCTCTGGCGGCAACACAGATGCAAGCTCCACTGGCGGAGCGTCATCGA
CGAGAACAGCGTCACCCCAGGCCTCAGGCTCACAGGGTGCAGCAGCCTCCATGCAGGCGCCCGCCTTCGGAAGCG
GAATCTTGGCCTTGATTGGAGCAGCTCTGTTGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail