Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2388
Gene name
LocationContig_174:10694..11799
Strand+
Gene length (bp)1105
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03006 HlyIII Haemolysin-III related 1.6E-61 67 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12442|IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH2 PE=1 SV=2 29 306 2.0E-70
sp|Q09749|ADRL_SCHPO ADIPOR-like receptor SPBC12C2.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.09c PE=3 SV=1 27 310 1.0E-68
sp|Q8BQS5|ADR2_MOUSE Adiponectin receptor protein 2 OS=Mus musculus GN=Adipor2 PE=1 SV=2 27 313 2.0E-60
sp|Q86V24|ADR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens GN=ADIPOR2 PE=1 SV=1 27 313 3.0E-60
sp|Q96A54|ADR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapiens GN=ADIPOR1 PE=1 SV=1 3 298 3.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12442|IZH2_YEAST ADIPOR-like receptor IZH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH2 PE=1 SV=2 29 306 2.0E-70
sp|Q09749|ADRL_SCHPO ADIPOR-like receptor SPBC12C2.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.09c PE=3 SV=1 27 310 1.0E-68
sp|Q8BQS5|ADR2_MOUSE Adiponectin receptor protein 2 OS=Mus musculus GN=Adipor2 PE=1 SV=2 27 313 2.0E-60
sp|Q86V24|ADR2_HUMAN Adiponectin receptor protein 2 OS=Homo sapiens GN=ADIPOR2 PE=1 SV=1 27 313 3.0E-60
sp|Q96A54|ADR1_HUMAN Adiponectin receptor protein 1 OS=Homo sapiens GN=ADIPOR1 PE=1 SV=1 3 298 3.0E-59
sp|Q91VH1|ADR1_MOUSE Adiponectin receptor protein 1 OS=Mus musculus GN=Adipor1 PE=1 SV=1 3 298 5.0E-59
sp|Q9VCY8|ADRL_DROME Adiponectin receptor protein OS=Drosophila melanogaster GN=AdipoR PE=1 SV=2 34 315 2.0E-58
sp|Q94177|ADRL_CAEEL Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis elegans GN=paqr-1 PE=3 SV=2 23 315 1.0E-56
sp|Q03419|IZH1_YEAST ADIPOR-like receptor IZH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH1 PE=1 SV=1 27 306 7.0E-54
sp|Q753H5|IZH1_ASHGO ADIPOR-like receptor IZH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH1 PE=3 SV=1 29 295 1.0E-48
sp|Q93ZH9|HHP1_ARATH Heptahelical transmembrane protein 1 OS=Arabidopsis thaliana GN=HHP1 PE=1 SV=1 4 294 1.0E-40
sp|Q9SVF3|HPP5_ARATH Heptahelical transmembrane protein 5 OS=Arabidopsis thaliana GN=HHP5 PE=2 SV=1 116 294 2.0E-39
sp|Q9SZG0|HHP4_ARATH Heptahelical transmembrane protein 4 OS=Arabidopsis thaliana GN=HHP4 PE=2 SV=1 116 294 7.0E-39
sp|Q10PI5|ADPO3_ORYSJ Heptahelical transmembrane protein ADIPOR3 OS=Oryza sativa subsp. japonica GN=ADIPOR3 PE=2 SV=1 116 294 1.0E-38
sp|A8WZU4|ADRL_CAEBR Progestin and adipoQ receptor-like protein 1 OS=Caenorhabditis briggsae GN=paqr-1 PE=3 SV=2 23 315 4.0E-36
sp|Q9ZUH8|HHP3_ARATH Heptahelical transmembrane protein 3 OS=Arabidopsis thaliana GN=HHP3 PE=2 SV=2 29 294 9.0E-35
sp|Q84N34|HHP2_ARATH Heptahelical transmembrane protein 2 OS=Arabidopsis thaliana GN=HHP2 PE=2 SV=1 12 294 4.0E-30
sp|Q6ETK9|ADPO2_ORYSJ Heptahelical transmembrane protein ADIPOR2 OS=Oryza sativa subsp. japonica GN=ADIPOR2 PE=2 SV=1 119 316 9.0E-30
sp|Q09910|YAJB_SCHPO Uncharacterized protein C30D11.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.11 PE=4 SV=1 28 303 7.0E-25
sp|B7F9G7|ADPO1_ORYSJ Heptahelical transmembrane protein ADIPOR1 OS=Oryza sativa subsp. japonica GN=ADIPOR1 PE=2 SV=1 116 288 2.0E-24
sp|Q6TCG8|PAQR3_MOUSE Progestin and adipoQ receptor family member 3 OS=Mus musculus GN=Paqr3 PE=2 SV=1 31 289 1.0E-18
sp|Q6TCH7|PAQR3_HUMAN Progestin and adipoQ receptor family member 3 OS=Homo sapiens GN=PAQR3 PE=1 SV=2 31 289 2.0E-18
sp|Q801G2|MPRAB_DANRE Membrane progestin receptor alpha-B OS=Danio rerio GN=paqr7b PE=1 SV=1 32 295 1.0E-12
sp|Q8N4S7|PAQR4_HUMAN Progestin and adipoQ receptor family member 4 OS=Homo sapiens GN=PAQR4 PE=2 SV=3 31 288 1.0E-12
sp|Q9JJE4|PAQR4_MOUSE Progestin and adipoQ receptor family member 4 OS=Mus musculus GN=Paqr4 PE=2 SV=1 31 288 1.0E-12
sp|Q801D8|MPRA_CYNNE Membrane progestin receptor alpha OS=Cynoscion nebulosus GN=mpra PE=1 SV=1 35 304 1.0E-10
sp|Q07959|IZH3_YEAST ADIPOR-like receptor IZH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH3 PE=1 SV=1 36 267 7.0E-09
sp|Q6ZVX9|PAQR9_HUMAN Progestin and adipoQ receptor family member 9 OS=Homo sapiens GN=PAQR9 PE=2 SV=1 29 296 4.0E-08
sp|Q75F81|IZH3_ASHGO ADIPOR-like receptor IZH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IZH3 PE=3 SV=1 29 267 5.0E-08
sp|Q99393|IZH4_YEAST ADIPOR-like receptor IZH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IZH4 PE=1 SV=1 70 310 5.0E-08
sp|Q9NXK6|MPRG_HUMAN Membrane progestin receptor gamma OS=Homo sapiens GN=PAQR5 PE=1 SV=2 51 295 6.0E-08
sp|Q9DCU0|MPRG_MOUSE Membrane progestin receptor gamma OS=Mus musculus GN=Paqr5 PE=2 SV=1 51 295 1.0E-07
sp|Q6TCG5|PAQR6_MOUSE Progestin and adipoQ receptor family member 6 OS=Mus musculus GN=Paqr6 PE=2 SV=1 26 290 6.0E-07
sp|Q865K9|MPRB_PIG Membrane progestin receptor beta OS=Sus scrofa GN=PAQR8 PE=2 SV=1 35 309 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 115 137 22
3 150 172 22
4 177 199 22
5 206 228 22
6 243 262 19
7 282 299 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2388
MTPSQPNGAIRQRRRPLSPKATVRAVEQRALVLWNDLPAWRRDNVHIRSAYRPIRASYCDALISLTYLHNESVNI
WSHLLAALSALALGLAALYCYHSHRHAILVAPANSSDAIVFACFASGAVLCLGMSATYHAVMDHSETVARWGNKL
DYTGIVALIVGSNVPVLYYGLFCEPTLFTAYLALICILGIGCVAVAWLERFRTSEWRAYRACMFIGLGISGVIPG
IHGLKLYGYEELQVRMSINWVAAQGALYIFGAVLYASRWPERNNPGKFDVWGSSHQLFHVLVVMAAATHLYGMVK
AFNHHHHVLGSQCHIT*
Coding >OphauB2|2388
ATGACGCCATCCCAGCCTAACGGCGCGATACGCCAACGACGTCGGCCACTATCGCCCAAGGCCACAGTAAGGGCC
GTTGAACAGCGTGCCCTCGTGCTCTGGAACGACCTGCCAGCCTGGCGTCGCGACAATGTTCATATTCGCTCTGCC
TATCGTCCCATTCGTGCCTCTTACTGCGACGCTCTGATCTCTCTCACGTATCTGCACAATGAGTCGGTTAATATT
TGGTCACATCTGTTAGCCGCCCTGTCAGCACTCGCTCTCGGCCTCGCTGCCCTGTACTGCTACCATTCGCATCGC
CATGCAATACTAGTGGCCCCCGCCAATTCTAGCGACGCCATTGTCTTTGCATGCTTTGCCAGCGGTGCAGTGCTG
TGCCTCGGCATGAGTGCCACGTATCACGCCGTCATGGACCATAGCGAGACGGTGGCACGTTGGGGCAATAAACTC
GACTATACTGGCATTGTGGCGCTCATTGTGGGCAGTAATGTGCCTGTATTGTACTATGGCTTGTTTTGCGAGCCA
ACTTTATTCACAGCATACCTTGCCCTAATTTGTATTCTAGGCATTGGCTGCGTCGCAGTGGCATGGCTGGAGCGC
TTTCGAACCTCGGAATGGCGTGCTTACCGCGCCTGCATGTTTATCGGTCTAGGTATCTCGGGCGTCATTCCCGGC
ATTCATGGCCTCAAGCTCTACGGCTACGAGGAGCTCCAGGTACGCATGAGCATCAATTGGGTTGCTGCCCAGGGC
GCACTGTACATTTTTGGTGCAGTACTCTATGCATCTCGGTGGCCGGAGCGCAACAATCCAGGCAAGTTTGATGTT
TGGGGGAGTTCACATCAACTGTTTCACGTCTTGGTCGTCATGGCTGCTGCAACGCACTTGTATGGCATGGTCAAG
GCATTCAACCATCACCATCATGTTCTCGGTTCCCAATGTCACATTACATGA
Transcript >OphauB2|2388
ATGACGCCATCCCAGCCTAACGGCGCGATACGCCAACGACGTCGGCCACTATCGCCCAAGGCCACAGTAAGGGCC
GTTGAACAGCGTGCCCTCGTGCTCTGGAACGACCTGCCAGCCTGGCGTCGCGACAATGTTCATATTCGCTCTGCC
TATCGTCCCATTCGTGCCTCTTACTGCGACGCTCTGATCTCTCTCACGTATCTGCACAATGAGTCGGTTAATATT
TGGTCACATCTGTTAGCCGCCCTGTCAGCACTCGCTCTCGGCCTCGCTGCCCTGTACTGCTACCATTCGCATCGC
CATGCAATACTAGTGGCCCCCGCCAATTCTAGCGACGCCATTGTCTTTGCATGCTTTGCCAGCGGTGCAGTGCTG
TGCCTCGGCATGAGTGCCACGTATCACGCCGTCATGGACCATAGCGAGACGGTGGCACGTTGGGGCAATAAACTC
GACTATACTGGCATTGTGGCGCTCATTGTGGGCAGTAATGTGCCTGTATTGTACTATGGCTTGTTTTGCGAGCCA
ACTTTATTCACAGCATACCTTGCCCTAATTTGTATTCTAGGCATTGGCTGCGTCGCAGTGGCATGGCTGGAGCGC
TTTCGAACCTCGGAATGGCGTGCTTACCGCGCCTGCATGTTTATCGGTCTAGGTATCTCGGGCGTCATTCCCGGC
ATTCATGGCCTCAAGCTCTACGGCTACGAGGAGCTCCAGGTACGCATGAGCATCAATTGGGTTGCTGCCCAGGGC
GCACTGTACATTTTTGGTGCAGTACTCTATGCATCTCGGTGGCCGGAGCGCAACAATCCAGGCAAGTTTGATGTT
TGGGGGAGTTCACATCAACTGTTTCACGTCTTGGTCGTCATGGCTGCTGCAACGCACTTGTATGGCATGGTCAAG
GCATTCAACCATCACCATCATGTTCTCGGTTCCCAATGTCACATTACATGA
Gene >OphauB2|2388
ATGACGCCATCCCAGCCTAACGGCGCGATACGCCAACGACGTCGGCCACTATCGCCCAAGGCCACAGTAAGGGCC
GTTGAACAGCGTGCCCTCGTGCTCTGGAACGACCTGCCAGCCTGGCGTCGCGACAATGTTCATATTCGCTCTGCC
TATCGTCCCATTCGTGCCTCTTACTGCGACGCTCTGATCTCTCTCACGTATCTGCACAATGAGTCGGTTAATATT
TGGTCACATCTGTTAGCCGCCCTGTCAGCACTCGCTCTCGGCCTCGCTGCCCTGTACTGCTACCATTCGCATCGC
CATGCAATACTAGTGGCCCCCGCCAATTCTAGCGACGCCATTGTCTTTGCATGCTTTGCCAGCGGTGCAGTGCTG
TGCCTCGGCATGAGTGCCACGTATCACGCCGTCATGGACCATAGCGAGACGGTGGCACGTTGGGGCAATAAACTC
GACTATACTGGCATTGTGGCGCTCATTGTGGGCAGTAATGTGCCTGTATTGTACTATGGCTTGTTTTGCGAGCCA
ACTTTATTCACAGCATACCTTGCCCTAGTAAGTCAAACAATTGTTCCATCTAGGCGTCTTTGATGCCATGCTAGA
GGCGTTTTAATTGACTTGAGAGGGGCCCAAAAAAAAAAAAAGATTTGTATTCTAGGCATTGGCTGCGTCGCAGTG
GCATGGCTGGAGCGCTTTCGAACCTCGGAATGGCGTGCTTACCGCGCCTGCATGTTTATCGGTCTAGGTATCTCG
GGCGTCATTCCCGGCATTCATGGCCTCAAGCTCTACGGCTACGAGGAGCTCCAGGTACGCATGAGCATCAATTGG
GTTGCTGCCCAGGGCGCACTGTACATTTTTGGTGCAGTACTCTATGCAGTGAGCTTCCTCGATATACTGCTGTTT
GTTGCTCCAACCATGCTGACTACTTCCACTTGGACAGTCTCGGTGGCCGGAGCGCAACAATCCAGGCAAGTTTGA
TGTTTGGGGGAGTTCACATCAACTGTTTCACGTCTTGGTCGTCATGGCTGCTGCAACGCACTTGTATGGCATGGT
CAAGGCATTCAACCATCACCATCATGTTCTCGGTTCCCAATGTCACATTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail