Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2380
Gene name
LocationContig_173:22873..24139
Strand-
Gene length (bp)1266
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 5.1E-26 86 377
PF07969 Amidohydro_3 Amidohydrolase family 4.0E-12 278 366

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q92VC6|ADEC2_RHIME Adenine deaminase 2 OS=Rhizobium meliloti (strain 1021) GN=ade2 PE=3 SV=1 26 382 1.0E-07
sp|Q8RFG1|HUTI_FUSNN Imidazolonepropionase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hutI PE=3 SV=1 230 356 7.0E-07
sp|Q1GSH1|HUTI_SPHAL Imidazolonepropionase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hutI PE=3 SV=1 233 355 9.0E-07

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2380
MQIQTILQATWLLALSHFTQAASFTIANANVIDVTTGKIQQQQDVVIQNDKIASIQAAGKNANAKAAGKNATAKA
DNNVFDASGLFLMPGFSDMHIHAYFTNDASKFAATDNATFPAFIANGVTHVRDLGSNFDAVLSAQKRINAKQLVG
PRISSTSGPILDGPKTPFQTVEKIQSQDDADSVVNELSNGGADFIKVHLKLDQDAFQAIASACTENNIPFGGHVP
DSIDVETAVKAGMTIFEHMSRIQTNDDVDLIGGNNFIATCTLVQGATDNRKKLCRSLHEKGTQVLSGTDAPQGPG
LCPGPSLHRELELMASSGISNLEVLQATTINAAKAVGLDSQIGTVEVGKAADLVMLSKNPLDNIQNTRSVAAVVA
NGALFSSDDLQQLSKSANVVKTLPFACGDKKAQKLAARTAVTCCSV*
Coding >OphauB2|2380
ATGCAGATTCAAACCATTTTGCAGGCGACATGGCTTCTCGCACTATCTCATTTCACGCAAGCCGCATCGTTTACA
ATTGCCAATGCCAATGTCATTGACGTGACAACAGGCAAAATTCAACAACAGCAGGATGTCGTTATCCAAAACGAC
AAGATTGCAAGCATCCAAGCCGCGGGAAAGAACGCAAACGCAAAAGCCGCGGGAAAGAACGCAACCGCAAAAGCC
GACAATAATGTCTTTGACGCCTCGGGTCTCTTCCTCATGCCGGGCTTTAGCGACATGCATATCCATGCCTACTTT
ACCAACGACGCCTCAAAGTTCGCAGCAACAGACAACGCCACCTTTCCCGCCTTTATTGCCAACGGCGTCACACAC
GTCCGCGATCTCGGCAGCAACTTTGACGCCGTCTTGTCTGCGCAGAAACGCATCAATGCTAAACAACTCGTCGGC
CCGCGCATCTCCTCTACTTCAGGCCCAATCCTTGACGGACCCAAGACGCCTTTTCAAACTGTAGAAAAGATTCAA
TCCCAGGACGACGCAGACTCTGTGGTTAACGAACTTTCAAACGGAGGCGCCGACTTTATAAAGGTGCATCTCAAG
CTCGACCAGGATGCCTTTCAAGCCATTGCCTCGGCATGCACCGAGAACAACATTCCATTCGGCGGCCACGTGCCC
GACTCAATCGACGTTGAAACAGCAGTTAAAGCCGGCATGACTATTTTCGAGCACATGAGTCGCATCCAAACCAAC
GACGATGTCGACTTGATTGGAGGCAACAACTTCATCGCAACGTGTACCCTCGTGCAAGGGGCGACAGACAACCGC
AAGAAGCTCTGTCGCAGTCTGCATGAAAAGGGCACCCAAGTCCTCTCTGGCACCGACGCGCCACAGGGCCCAGGC
CTCTGTCCAGGACCCAGCCTGCACAGAGAACTCGAGCTCATGGCCTCGTCGGGCATTTCGAATTTGGAAGTGCTT
CAAGCAACCACCATTAATGCTGCAAAAGCGGTGGGCTTGGATTCCCAAATCGGCACCGTCGAAGTAGGCAAGGCG
GCAGATCTCGTCATGCTGAGCAAGAATCCCCTTGACAATATTCAAAACACGCGCAGTGTTGCTGCTGTTGTTGCA
AATGGCGCCTTGTTCTCGAGCGACGATTTGCAGCAGTTGAGCAAGTCTGCCAATGTTGTCAAGACGCTTCCGTTT
GCCTGCGGCGATAAAAAAGCTCAAAAGTTGGCAGCACGAACTGCAGTTACCTGCTGTTCTGTCTAG
Transcript >OphauB2|2380
ATGCAGATTCAAACCATTTTGCAGGCGACATGGCTTCTCGCACTATCTCATTTCACGCAAGCCGCATCGTTTACA
ATTGCCAATGCCAATGTCATTGACGTGACAACAGGCAAAATTCAACAACAGCAGGATGTCGTTATCCAAAACGAC
AAGATTGCAAGCATCCAAGCCGCGGGAAAGAACGCAAACGCAAAAGCCGCGGGAAAGAACGCAACCGCAAAAGCC
GACAATAATGTCTTTGACGCCTCGGGTCTCTTCCTCATGCCGGGCTTTAGCGACATGCATATCCATGCCTACTTT
ACCAACGACGCCTCAAAGTTCGCAGCAACAGACAACGCCACCTTTCCCGCCTTTATTGCCAACGGCGTCACACAC
GTCCGCGATCTCGGCAGCAACTTTGACGCCGTCTTGTCTGCGCAGAAACGCATCAATGCTAAACAACTCGTCGGC
CCGCGCATCTCCTCTACTTCAGGCCCAATCCTTGACGGACCCAAGACGCCTTTTCAAACTGTAGAAAAGATTCAA
TCCCAGGACGACGCAGACTCTGTGGTTAACGAACTTTCAAACGGAGGCGCCGACTTTATAAAGGTGCATCTCAAG
CTCGACCAGGATGCCTTTCAAGCCATTGCCTCGGCATGCACCGAGAACAACATTCCATTCGGCGGCCACGTGCCC
GACTCAATCGACGTTGAAACAGCAGTTAAAGCCGGCATGACTATTTTCGAGCACATGAGTCGCATCCAAACCAAC
GACGATGTCGACTTGATTGGAGGCAACAACTTCATCGCAACGTGTACCCTCGTGCAAGGGGCGACAGACAACCGC
AAGAAGCTCTGTCGCAGTCTGCATGAAAAGGGCACCCAAGTCCTCTCTGGCACCGACGCGCCACAGGGCCCAGGC
CTCTGTCCAGGACCCAGCCTGCACAGAGAACTCGAGCTCATGGCCTCGTCGGGCATTTCGAATTTGGAAGTGCTT
CAAGCAACCACCATTAATGCTGCAAAAGCGGTGGGCTTGGATTCCCAAATCGGCACCGTCGAAGTAGGCAAGGCG
GCAGATCTCGTCATGCTGAGCAAGAATCCCCTTGACAATATTCAAAACACGCGCAGTGTTGCTGCTGTTGTTGCA
AATGGCGCCTTGTTCTCGAGCGACGATTTGCAGCAGTTGAGCAAGTCTGCCAATGTTGTCAAGACGCTTCCGTTT
GCCTGCGGCGATAAAAAAGCTCAAAAGTTGGCAGCACGAACTGCAGTTACCTGCTGTTCTGTCTAG
Gene >OphauB2|2380
ATGCAGATTCAAACCATTTTGCAGGCGACATGGCTTCTCGCACTATCTCATTTCACGCAAGCCGCATCGTTTACA
ATTGCCAATGCCAATGTCATTGACGTGACAACAGGCAAAATTCAACAACAGCAGGATGTCGTTATCCAAAACGAC
AAGATTGCAAGCATCCAAGCCGCGGGAAAGAACGCAAACGCAAAAGCCGCGGGAAAGAACGCAACCGCAAAAGCC
GACAATAATGTCTTTGACGCCTCGGGTCTCTTCCTCATGCCGGGCTTTAGCGACATGCATATCCATGCCTACTTT
ACCAACGACGCCTCAAAGTTCGCAGCAACAGACAACGCCACCTTTCCCGCCTTTATTGCCAACGGCGTCACACAC
GTCCGCGATCTCGGCAGCAACTTTGACGCCGTCTTGTCTGCGCAGAAACGCATCAATGCTAAACAACTCGTCGGC
CCGCGCATCTCCTCTACTTCAGGCCCAATCCTTGACGGACCCAAGACGCCTTTTCAAACTGTAGAAAAGATTCAA
TCCCAGGACGACGCAGACTCTGTGGTTAACGAACTTTCAAACGGAGGCGCCGACTTTATAAAGGTGCATCTCAAG
CTCGACCAGGATGCCTTTCAAGCCATTGCCTCGGCATGCACCGAGAACAACATTCCATTCGGCGGCCACGTGCCC
GACTCAATCGACGTTGAAACAGCAGTTAAAGCCGGCATGACTATTTTCGAGCACATGAGTCGCATCCAAACCAAC
GACGATGTCGACTTGATTGGAGGCAACAACTTCATCGCAACGTGTACCCTCGTGCAAGGGGCGACAGACAACCGC
AAGAAGCTCTGTCGCAGTCTGCATGAAAAGGGCACCCAAGTCCTCTCTGGCACCGACGCGCCACAGGGCCCAGGC
CTCTGTCCAGGACCCAGCCTGCACAGAGAACTCGAGCTCATGGCCTCGTCGGGCATTTCGAATTTGGAAGTGCTT
CAAGCAACCACCATTAATGCTGCAAAAGCGGTGGGCTTGGATTCCCAAATCGGCACCGTCGAAGTAGGCAAGGCG
GCAGATCTCGTCATGCTGAGCAAGAATCCCCTTGACAATATTCAAAACACGCGCAGTGTTGCTGCTGTTGTTGCA
AATGGCGCCTTGTTCTCGAGCGACGATTTGCAGCAGTTGAGCAAGTCTGCCAATGTTGTCAAGACGCTTCCGTTT
GCCTGCGGCGATAAAAAAGCTCAAAAGTTGGCAGCACGAACTGCAGTTACCTGCTGTTCTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail