Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2369
Gene name
LocationContig_172:40048..41991
Strand-
Gene length (bp)1943
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 2.1E-169 32 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 1 523 0.0E+00
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 1 529 0.0E+00
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 4 531 0.0E+00
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 4 528 0.0E+00
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 4 531 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 1 523 0.0E+00
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 1 529 0.0E+00
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 4 531 0.0E+00
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 4 528 0.0E+00
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 4 531 0.0E+00
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 4 531 0.0E+00
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 4 528 0.0E+00
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 4 531 0.0E+00
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 3 528 0.0E+00
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 2 531 0.0E+00
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 1 528 0.0E+00
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 4 534 0.0E+00
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 1 524 0.0E+00
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 2 531 0.0E+00
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 1 534 0.0E+00
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 21 526 6.0E-161
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 4 525 2.0E-140
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 4 525 5.0E-131
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 3 526 6.0E-129
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 4 524 3.0E-128
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 4 526 8.0E-128
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 4 524 1.0E-127
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 4 526 2.0E-127
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 15 526 2.0E-127
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 4 537 2.0E-125
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 4 537 9.0E-125
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 2 524 1.0E-123
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 4 528 1.0E-122
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 4 528 1.0E-122
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 4 526 1.0E-122
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 4 524 3.0E-122
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 4 534 8.0E-122
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 4 523 9.0E-122
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 1 537 1.0E-121
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 2 525 2.0E-121
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 1 524 1.0E-120
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 2 527 1.0E-119
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 1 524 4.0E-119
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsA PE=3 SV=2 4 535 7.0E-118
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 4 536 3.0E-117
sp|O30561|THS1_HALVD Thermosome subunit 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct1 PE=1 SV=1 4 524 2.0E-116
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 15 517 3.0E-116
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 2 524 1.0E-115
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 4 530 3.0E-110
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 4 535 4.0E-110
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 4 526 6.0E-110
sp|O24735|THSB_SULTO Thermosome subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsB PE=1 SV=1 4 524 2.0E-107
sp|O30560|THS2_HALVD Thermosome subunit 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct2 PE=1 SV=1 4 531 7.0E-100
sp|Q9HHA2|THS3_HALVD Thermosome subunit 3 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct3 PE=1 SV=2 1 525 2.0E-96
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 15 522 4.0E-96
sp|Q54TD3|TCPE_DICDI T-complex protein 1 subunit epsilon OS=Dictyostelium discoideum GN=cct5 PE=3 SV=1 5 521 1.0E-93
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 2 529 3.0E-93
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 15 522 6.0E-92
sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 1 533 2.0E-91
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 4 521 2.0E-91
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 4 521 2.0E-91
sp|P47209|TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans GN=cct-5 PE=2 SV=1 4 521 3.0E-91
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 4 521 4.0E-91
sp|O04450|TCPE_ARATH T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana GN=CCT5 PE=1 SV=1 4 523 5.0E-91
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 1 520 1.0E-90
sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 1 520 2.0E-90
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCT4 PE=3 SV=1 24 525 2.0E-90
sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 1 520 5.0E-90
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 1 520 7.0E-90
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 5 524 8.0E-90
sp|Q9HNI0|THSB_HALSA Thermosome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsB PE=3 SV=2 1 524 1.0E-88
sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus GN=Cct5 PE=1 SV=1 4 521 2.0E-88
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 1 520 2.0E-88
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 2 533 4.0E-88
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 4 521 5.0E-88
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus GN=Cct4 PE=1 SV=3 14 525 7.0E-88
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus norvegicus GN=Cct4 PE=1 SV=3 14 525 2.0E-87
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens GN=CCT4 PE=1 SV=4 14 525 2.0E-87
sp|P54411|TCPE2_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 4 523 4.0E-87
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo abelii GN=CCT4 PE=2 SV=3 14 525 1.0E-86
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos taurus GN=CCT4 PE=1 SV=3 14 525 4.0E-86
sp|P40413|TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT5 PE=1 SV=3 1 521 7.0E-86
sp|P28769|TCPA_ARATH T-complex protein 1 subunit alpha OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 12 531 3.0E-85
sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 1 529 4.0E-85
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 14 525 1.0E-84
sp|O15891|TCPA_TETPY T-complex protein 1 subunit alpha OS=Tetrahymena pyriformis PE=3 SV=1 13 521 2.0E-84
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1 24 524 2.0E-84
sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1 3 525 4.0E-84
sp|Q9SF16|TCPH_ARATH T-complex protein 1 subunit eta OS=Arabidopsis thaliana GN=CCT7 PE=1 SV=1 1 528 5.0E-84
sp|P53451|TCPD_TAKRU T-complex protein 1 subunit delta OS=Takifugu rubripes GN=cct4 PE=2 SV=1 14 525 3.0E-83
sp|Q9LV21|TCPD_ARATH T-complex protein 1 subunit delta OS=Arabidopsis thaliana GN=CCT4 PE=1 SV=1 22 525 2.0E-82
sp|O94501|TCPA_SCHPO T-complex protein 1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct1 PE=3 SV=1 1 519 3.0E-81
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 9 525 2.0E-80
sp|Q94757|TCPA_SCHMA T-complex protein 1 subunit alpha OS=Schistosoma mansoni GN=TCP-1A PE=2 SV=1 8 529 2.0E-80
sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 1 531 2.0E-80
sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 1 531 3.0E-80
sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 12 536 4.0E-80
sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 1 521 6.0E-80
sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 1 521 8.0E-80
sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 1 521 8.0E-80
sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 1 520 1.0E-79
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 1 525 1.0E-79
sp|Q9NB32|TCPD_OCHTR T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus PE=2 SV=1 24 521 1.0E-79
sp|P41988|TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans GN=cct-1 PE=3 SV=2 12 536 3.0E-79
sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 1 531 9.0E-79
sp|P40412|TCPE1_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 35 523 1.0E-78
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 1 525 2.0E-78
sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 1 534 9.0E-78
sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 1 521 1.0E-77
sp|Q55BM4|TCPA_DICDI T-complex protein 1 subunit alpha OS=Dictyostelium discoideum GN=tcp1 PE=2 SV=1 1 531 8.0E-77
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 9 525 8.0E-75
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT4 PE=1 SV=2 9 525 1.0E-74
sp|P12612|TCPA_YEAST T-complex protein 1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCP1 PE=1 SV=2 13 519 2.0E-72
sp|Q8SSC9|TCPA_ENCCU T-complex protein 1 subunit alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TCP1 PE=1 SV=1 13 521 1.0E-70
sp|Q8SRP9|TCPE_ENCCU T-complex protein 1 subunit epsilon OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT5 PE=1 SV=1 7 523 2.0E-70
sp|Q5ZJ54|TCPZ_CHICK T-complex protein 1 subunit zeta OS=Gallus gallus GN=CCT6 PE=1 SV=3 20 524 5.0E-70
sp|O77622|TCPZ_RABIT T-complex protein 1 subunit zeta OS=Oryctolagus cuniculus GN=CCT6 PE=1 SV=3 20 524 2.0E-68
sp|Q5RCD2|TCPZ_PONAB T-complex protein 1 subunit zeta OS=Pongo abelii GN=CCT6 PE=2 SV=3 20 524 3.0E-68
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 20 524 4.0E-68
sp|P47207|TCPB_CAEEL T-complex protein 1 subunit beta OS=Caenorhabditis elegans GN=cct-2 PE=1 SV=2 4 524 7.0E-68
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 20 524 9.0E-68
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 20 524 4.0E-67
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 21 527 2.0E-66
sp|Q92526|TCPW_HUMAN T-complex protein 1 subunit zeta-2 OS=Homo sapiens GN=CCT6B PE=1 SV=5 25 524 1.0E-65
sp|Q61390|TCPW_MOUSE T-complex protein 1 subunit zeta-2 OS=Mus musculus GN=Cct6b PE=1 SV=4 25 524 4.0E-65
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 14 528 5.0E-65
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 3 529 5.0E-65
sp|Q76NU3|TCPZ_DICDI T-complex protein 1 subunit zeta OS=Dictyostelium discoideum GN=cct6 PE=1 SV=1 5 530 4.0E-63
sp|Q3T084|TCPW_BOVIN T-complex protein 1 subunit zeta-2 OS=Bos taurus GN=CCT6B PE=2 SV=3 20 524 4.0E-63
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 3 529 7.0E-63
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 3 529 1.0E-62
sp|Q4R6F8|TCPB_MACFA T-complex protein 1 subunit beta OS=Macaca fascicularis GN=CCT2 PE=2 SV=3 3 529 3.0E-62
sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens GN=CCT2 PE=1 SV=4 3 529 3.0E-62
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 25 527 1.0E-61
sp|Q940P8|TCPB_ARATH T-complex protein 1 subunit beta OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 4 526 4.0E-61
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 13 525 9.0E-61
sp|Q54ES9|TCPB_DICDI T-complex protein 1 subunit beta OS=Dictyostelium discoideum GN=cct2 PE=1 SV=1 3 524 2.0E-60
sp|P46550|TCPZ_CAEEL T-complex protein 1 subunit zeta OS=Caenorhabditis elegans GN=cct-6 PE=1 SV=1 25 524 3.0E-60
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 2 527 3.0E-60
sp|Q94K05|TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana GN=CCT8 PE=1 SV=1 21 527 2.0E-59
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 4 524 6.0E-59
sp|A8X6I9|TCPQ_CAEBR T-complex protein 1 subunit theta OS=Caenorhabditis briggsae GN=cct-8 PE=3 SV=1 25 530 5.0E-58
sp|Q8L7N0|TCPZB_ARATH T-complex protein 1 subunit zeta 2 OS=Arabidopsis thaliana GN=CCT6B PE=1 SV=1 26 526 6.0E-57
sp|Q9M888|TCPZA_ARATH T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana GN=CCT6A PE=1 SV=1 26 526 3.0E-55
sp|P54410|TCPH_TETTH T-complex protein 1 subunit eta (Fragment) OS=Tetrahymena thermophila PE=3 SV=1 60 413 3.0E-55
sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus GN=Cct8 PE=1 SV=3 21 527 3.0E-55
sp|Q3ZCI9|TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus GN=CCT8 PE=1 SV=3 21 527 4.0E-55
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 25 527 2.0E-54
sp|Q9N358|TCPQ_CAEEL T-complex protein 1 subunit theta OS=Caenorhabditis elegans GN=cct-8 PE=1 SV=3 25 530 2.0E-53
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 21 521 4.0E-53
sp|Q5RAP1|TCPQ_PONAB T-complex protein 1 subunit theta OS=Pongo abelii GN=CCT8 PE=2 SV=3 21 527 5.0E-51
sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens GN=CCT8 PE=1 SV=4 21 527 5.0E-51
sp|Q4R5J0|TCPQ_MACFA T-complex protein 1 subunit theta OS=Macaca fascicularis GN=CCT8 PE=2 SV=1 21 527 1.0E-50
sp|Q8SSH3|TCPD_ENCCU T-complex protein 1 subunit delta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT4 PE=1 SV=1 20 526 1.0E-50
sp|Q8SQP2|TCPB_ENCCU T-complex protein 1 subunit beta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT2 PE=1 SV=1 16 525 1.0E-49
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 23 527 7.0E-49
sp|Q29068|TCPG_PIG T-complex protein 1 subunit gamma (Fragment) OS=Sus scrofa GN=CCT3 PE=2 SV=1 28 108 3.0E-40
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 21 527 1.0E-36
sp|Q96SF2|TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens GN=CCT8L2 PE=2 SV=2 23 527 4.0E-36
sp|A6NM43|TCPQL_HUMAN Putative T-complex protein 1 subunit theta-like 1 OS=Homo sapiens GN=CCT8L1P PE=5 SV=1 23 527 4.0E-34
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 167 469 5.0E-25
sp|Q9SSJ8|FAB1C_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C OS=Arabidopsis thaliana GN=FAB1C PE=2 SV=1 167 421 9.0E-23
sp|Q8SS33|TCPQ_ENCCU T-complex protein 1 subunit theta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT8 PE=1 SV=1 30 502 9.0E-23
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 193 450 2.0E-20
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 165 424 3.0E-20
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 143 424 1.0E-19
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 176 414 2.0E-19
sp|B1HT15|CH60_LYSSC 60 kDa chaperonin OS=Lysinibacillus sphaericus (strain C3-41) GN=groL PE=3 SV=1 32 523 5.0E-18
sp|Q19NJ4|CH602_ECOK1 60 kDa chaperonin 2 OS=Escherichia coli O1:K1 / APEC GN=groL2 PE=3 SV=1 14 529 6.0E-18
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 166 401 1.0E-17
sp|Q29236|TCPZ_PIG T-complex protein 1 subunit zeta (Fragment) OS=Sus scrofa GN=CCT6 PE=2 SV=1 25 121 2.0E-17
sp|O50305|CH60_BACHD 60 kDa chaperonin OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=groL PE=2 SV=2 19 525 2.0E-17
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 167 338 1.0E-16
sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 385 521 3.0E-16
sp|Q3BY61|CH60_XANC5 60 kDa chaperonin OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=groL PE=3 SV=1 14 523 3.0E-16
sp|Q607Q3|CH602_METCA 60 kDa chaperonin 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=groL2 PE=3 SV=1 26 535 4.0E-16
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 19 525 5.0E-16
sp|Q4FU94|CH60_PSYA2 60 kDa chaperonin OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=groL PE=3 SV=1 32 516 5.0E-16
sp|Q1QDC9|CH60_PSYCK 60 kDa chaperonin OS=Psychrobacter cryohalolentis (strain K5) GN=groL PE=3 SV=1 32 516 5.0E-16
sp|A5V0S2|CH602_ROSS1 60 kDa chaperonin 2 OS=Roseiflexus sp. (strain RS-1) GN=groL2 PE=3 SV=1 32 535 5.0E-16
sp|A5WD52|CH60_PSYWF 60 kDa chaperonin OS=Psychrobacter sp. (strain PRwf-1) GN=groL PE=3 SV=1 32 525 6.0E-16
sp|B1YEP6|CH60_EXIS2 60 kDa chaperonin OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=groL PE=3 SV=1 16 530 6.0E-16
sp|Q8PPZ1|CH60_XANAC 60 kDa chaperonin OS=Xanthomonas axonopodis pv. citri (strain 306) GN=groL PE=3 SV=1 14 523 8.0E-16
sp|Q0KDR7|CH60_CUPNH 60 kDa chaperonin OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=groL PE=3 SV=1 18 519 9.0E-16
sp|Q60AY0|CH601_METCA 60 kDa chaperonin 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=groL1 PE=3 SV=1 32 523 1.0E-15
sp|A9KSJ1|CH60_CLOPH 60 kDa chaperonin OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=groL PE=3 SV=1 27 516 1.0E-15
sp|Q8RIT7|CH60_XANCH 60 kDa chaperonin OS=Xanthomonas campestris pv. phaseoli GN=groL PE=3 SV=1 14 523 1.0E-15
sp|O66222|CH60_ERWAP 60 kDa chaperonin (Fragment) OS=Erwinia aphidicola GN=groL PE=3 SV=1 14 516 1.0E-15
sp|Q5SLM2|CH60_THET8 60 kDa chaperonin OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=groL PE=1 SV=3 16 536 2.0E-15
sp|P61490|CH60_THET2 60 kDa chaperonin OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=groL PE=1 SV=2 16 536 2.0E-15
sp|Q8PD23|CH60_XANCP 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=groL PE=3 SV=1 14 523 2.0E-15
sp|Q4UZA7|CH60_XANC8 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain 8004) GN=groL PE=3 SV=1 14 523 2.0E-15
sp|B0RN52|CH60_XANCB 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain B100) GN=groL PE=3 SV=1 14 523 2.0E-15
sp|A7NIK8|CH601_ROSCS 60 kDa chaperonin 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=groL1 PE=3 SV=1 32 536 2.0E-15
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 19 531 3.0E-15
sp|Q5GUT1|CH60_XANOR 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=groL PE=3 SV=1 14 523 3.0E-15
sp|B2SJG4|CH60_XANOP 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=groL PE=3 SV=1 14 523 3.0E-15
sp|Q2NY29|CH60_XANOM 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=groL PE=3 SV=1 14 523 3.0E-15
sp|A7GKG0|CH60_BACCN 60 kDa chaperonin OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=groL PE=3 SV=1 19 525 3.0E-15
sp|Q2SDG0|CH60_HAHCH 60 kDa chaperonin OS=Hahella chejuensis (strain KCTC 2396) GN=groL PE=3 SV=1 14 523 3.0E-15
sp|Q929V0|CH60_LISIN 60 kDa chaperonin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=groL PE=3 SV=1 19 536 3.0E-15
sp|Q93GT6|CH60_TETHA 60 kDa chaperonin OS=Tetragenococcus halophilus GN=groL PE=3 SV=2 19 534 4.0E-15
sp|B5XIW7|CH60_STRPZ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=groL PE=3 SV=1 32 525 6.0E-15
sp|Q48R03|CH60_STRPM 60 kDa chaperonin OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=groL PE=3 SV=1 32 525 6.0E-15
sp|Q1J4D1|CH60_STRPF 60 kDa chaperonin OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=groL PE=3 SV=1 32 525 6.0E-15
sp|Q1JJL5|CH60_STRPC 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=groL PE=3 SV=1 32 525 6.0E-15
sp|Q1J9G4|CH60_STRPB 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=groL PE=3 SV=1 32 525 6.0E-15
sp|A2RGR1|CH60_STRPG 60 kDa chaperonin OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=groL PE=3 SV=1 32 525 6.0E-15
sp|Q5X9L8|CH60_STRP6 60 kDa chaperonin OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=groL PE=1 SV=3 32 525 6.0E-15
sp|P69883|CH60_STRP1 60 kDa chaperonin OS=Streptococcus pyogenes serotype M1 GN=groL PE=3 SV=2 32 525 6.0E-15
sp|Q1JEL5|CH60_STRPD 60 kDa chaperonin OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=groL PE=3 SV=1 32 525 6.0E-15
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 19 530 6.0E-15
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 19 530 6.0E-15
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 19 530 6.0E-15
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 19 530 6.0E-15
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 19 531 7.0E-15
sp|P0DA23|CH60_STRPQ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=groL PE=3 SV=1 32 525 7.0E-15
sp|P0DA22|CH60_STRP3 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=groL PE=3 SV=1 32 525 7.0E-15
sp|B4SKL8|CH60_STRM5 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 14 523 1.0E-14
sp|B2FIU9|CH60_STRMK 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain K279a) GN=groL PE=3 SV=1 14 523 1.0E-14
sp|Q21MD3|CH60_SACD2 60 kDa chaperonin OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=groL PE=3 SV=1 18 530 1.0E-14
sp|Q8NZ56|CH60_STRP8 60 kDa chaperonin OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=groL PE=3 SV=3 32 525 1.0E-14
sp|O66220|CH60_PECCC 60 kDa chaperonin (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=groL PE=3 SV=1 14 516 1.0E-14
sp|Q46XW6|CH60_CUPPJ 60 kDa chaperonin OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=groL PE=3 SV=1 18 519 1.0E-14
sp|C6DKC7|CH60_PECCP 60 kDa chaperonin OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=groL PE=3 SV=1 14 516 1.0E-14
sp|B7IUT0|CH60_BACC2 60 kDa chaperonin OS=Bacillus cereus (strain G9842) GN=groL PE=3 SV=1 19 525 1.0E-14
sp|B7H4Q7|CH60_BACC4 60 kDa chaperonin OS=Bacillus cereus (strain B4264) GN=groL PE=3 SV=1 19 525 1.0E-14
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 19 531 1.0E-14
sp|A5EX17|CH60_DICNV 60 kDa chaperonin OS=Dichelobacter nodosus (strain VCS1703A) GN=groL PE=3 SV=1 32 531 2.0E-14
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 19 530 2.0E-14
sp|Q814B0|CH60_BACCR 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=groL PE=3 SV=1 19 525 2.0E-14
sp|C5BP08|CH60_TERTT 60 kDa chaperonin OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=groL PE=3 SV=1 14 531 2.0E-14
sp|B3R2Y3|CH60_CUPTR 60 kDa chaperonin OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=groL PE=3 SV=1 18 519 2.0E-14
sp|A7Z207|CH60_BACMF 60 kDa chaperonin OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=groL PE=3 SV=1 19 525 2.0E-14
sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=groL PE=3 SV=1 19 525 3.0E-14
sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin OS=Bacillus cereus (strain ZK / E33L) GN=groL PE=3 SV=1 19 525 3.0E-14
sp|B9J1H2|CH60_BACCQ 60 kDa chaperonin OS=Bacillus cereus (strain Q1) GN=groL PE=3 SV=1 19 525 3.0E-14
sp|B7HS05|CH60_BACC7 60 kDa chaperonin OS=Bacillus cereus (strain AH187) GN=groL PE=3 SV=1 19 525 3.0E-14
sp|C1EUB1|CH60_BACC3 60 kDa chaperonin OS=Bacillus cereus (strain 03BB102) GN=groL PE=3 SV=1 19 525 3.0E-14
sp|Q73ER9|CH60_BACC1 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=groL PE=3 SV=2 19 525 3.0E-14
sp|B7JM60|CH60_BACC0 60 kDa chaperonin OS=Bacillus cereus (strain AH820) GN=groL PE=3 SV=1 19 525 3.0E-14
sp|A0R8W4|CH60_BACAH 60 kDa chaperonin OS=Bacillus thuringiensis (strain Al Hakam) GN=groL PE=3 SV=1 19 525 3.0E-14
sp|Q4MPR6|CH60_BACCE 60 kDa chaperonin OS=Bacillus cereus GN=groL PE=1 SV=3 19 525 3.0E-14
sp|P26821|CH60_CLOPE 60 kDa chaperonin OS=Clostridium perfringens (strain 13 / Type A) GN=groL PE=3 SV=2 18 533 3.0E-14
sp|Q0VRW6|CH60_ALCBS 60 kDa chaperonin OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=groL PE=3 SV=1 32 536 4.0E-14
sp|O66210|CH60_KLEOX 60 kDa chaperonin (Fragment) OS=Klebsiella oxytoca GN=groL PE=3 SV=1 14 534 4.0E-14
sp|A9VQG8|CH60_BACWK 60 kDa chaperonin OS=Bacillus weihenstephanensis (strain KBAB4) GN=groL PE=3 SV=1 19 525 4.0E-14
sp|O66214|CH60_RAOOR 60 kDa chaperonin (Fragment) OS=Raoultella ornithinolytica GN=groL PE=3 SV=1 14 534 5.0E-14
sp|O66202|CH60_SERRU 60 kDa chaperonin (Fragment) OS=Serratia rubidaea GN=groL PE=3 SV=1 14 534 5.0E-14
sp|Q0TN27|CH60_CLOP1 60 kDa chaperonin OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=groL PE=3 SV=1 18 533 5.0E-14
sp|Q93N35|CH60_BUCRM 60 kDa chaperonin OS=Buchnera aphidicola subsp. Rhopalosiphum maidis GN=groL PE=3 SV=1 14 516 5.0E-14
sp|Q81VE1|CH60_BACAN 60 kDa chaperonin OS=Bacillus anthracis GN=groL PE=3 SV=1 19 525 6.0E-14
sp|C3L507|CH60_BACAC 60 kDa chaperonin OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=groL PE=3 SV=1 19 525 6.0E-14
sp|C3PAV1|CH60_BACAA 60 kDa chaperonin OS=Bacillus anthracis (strain A0248) GN=groL PE=3 SV=1 19 525 6.0E-14
sp|Q93GT8|CH60_COLMA 60 kDa chaperonin OS=Colwellia maris GN=groL PE=3 SV=2 18 523 7.0E-14
sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=groL PE=3 SV=2 32 525 8.0E-14
sp|P28598|CH60_BACSU 60 kDa chaperonin OS=Bacillus subtilis (strain 168) GN=groL PE=1 SV=3 19 525 8.0E-14
sp|Q9WWL4|CH60_METSS 60 kDa chaperonin OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=groL PE=3 SV=1 32 519 8.0E-14
sp|B2VL84|CH60_ERWT9 60 kDa chaperonin OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=groL PE=3 SV=1 14 516 9.0E-14
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 19 529 9.0E-14
sp|Q3JPF6|CH601_BURP1 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1710b) GN=groL1 PE=3 SV=1 18 519 9.0E-14
sp|A3NYH0|CH601_BURP0 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1106a) GN=groL1 PE=3 SV=1 18 519 9.0E-14
sp|A1V1Z9|CH60_BURMS 60 kDa chaperonin OS=Burkholderia mallei (strain SAVP1) GN=groL PE=3 SV=1 18 519 9.0E-14
sp|Q62I82|CH60_BURMA 60 kDa chaperonin OS=Burkholderia mallei (strain ATCC 23344) GN=groL PE=3 SV=1 18 519 9.0E-14
sp|A2S9S5|CH60_BURM9 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10229) GN=groL PE=3 SV=1 18 519 9.0E-14
sp|A3MMB4|CH60_BURM7 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10247) GN=groL PE=3 SV=1 18 519 9.0E-14
sp|Q058F3|CH60_BUCCC 60 kDa chaperonin OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=groL PE=3 SV=1 14 516 9.0E-14
sp|A9B6A4|CH60_HERA2 60 kDa chaperonin OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=groL PE=3 SV=1 32 523 1.0E-13
sp|A8FAG3|CH60_BACP2 60 kDa chaperonin OS=Bacillus pumilus (strain SAFR-032) GN=groL PE=3 SV=1 16 525 1.0E-13
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 16 534 1.0E-13
sp|O66200|CH60_ENTAG 60 kDa chaperonin (Fragment) OS=Enterobacter agglomerans GN=groL PE=3 SV=1 14 534 1.0E-13
sp|Q9F712|CH601_BURPS 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain K96243) GN=groL1 PE=3 SV=2 18 519 1.0E-13
sp|A3NCQ8|CH601_BURP6 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 668) GN=groL1 PE=3 SV=1 18 519 1.0E-13
sp|C5BDK5|CH60_EDWI9 60 kDa chaperonin OS=Edwardsiella ictaluri (strain 93-146) GN=groL PE=3 SV=1 14 516 1.0E-13
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 19 534 1.0E-13
sp|O66218|CH60_PANAN 60 kDa chaperonin (Fragment) OS=Pantoea ananas GN=groL PE=3 SV=1 14 516 2.0E-13
sp|P58723|CH60_BURTH 60 kDa chaperonin OS=Burkholderia thailandensis GN=groL PE=3 SV=1 18 519 2.0E-13
sp|Q2SYJ5|CH601_BURTA 60 kDa chaperonin 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL1 PE=3 SV=1 18 519 2.0E-13
sp|Q59177|CH60_BUCAP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=groL PE=3 SV=3 14 516 2.0E-13
sp|O66190|CH60_ENTAS 60 kDa chaperonin (Fragment) OS=Enterobacter asburiae GN=groL PE=3 SV=1 14 534 2.0E-13
sp|Q03VC3|CH60_LEUMM 60 kDa chaperonin OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=groL PE=3 SV=1 27 534 2.0E-13
sp|Q1H4F2|CH60_METFK 60 kDa chaperonin OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=groL PE=3 SV=1 20 534 2.0E-13
sp|Q1IW59|CH60_DEIGD 60 kDa chaperonin OS=Deinococcus geothermalis (strain DSM 11300) GN=groL PE=3 SV=1 32 529 2.0E-13
sp|C0MES3|CH60_STRS7 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=groL PE=3 SV=1 32 525 2.0E-13
sp|B9DW28|CH60_STRU0 60 kDa chaperonin OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=groL PE=3 SV=1 32 532 2.0E-13
sp|P25750|CH60_BUCAI 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=groL PE=3 SV=1 14 516 2.0E-13
sp|B8D8I2|CH60_BUCA5 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=groL PE=3 SV=1 14 516 2.0E-13
sp|P59526|CH60_BUCBP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=groL PE=3 SV=1 14 516 3.0E-13
sp|B8D6T6|CH60_BUCAT 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=groL PE=3 SV=1 14 516 3.0E-13
sp|C4LCA2|CH60_TOLAT 60 kDa chaperonin OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=groL PE=3 SV=1 14 516 3.0E-13
sp|Q8KJ18|CH60_STRCV 60 kDa chaperonin OS=Streptococcus constellatus GN=groL PE=3 SV=1 32 525 3.0E-13
sp|P81284|CH60_TANFO 60 kDa chaperonin OS=Tannerella forsythia GN=groL PE=1 SV=3 32 526 3.0E-13
sp|O66204|CH60_SERFI 60 kDa chaperonin (Fragment) OS=Serratia ficaria GN=groL PE=3 SV=1 14 534 4.0E-13
sp|O66206|CH60_SERMA 60 kDa chaperonin (Fragment) OS=Serratia marcescens GN=groL PE=3 SV=1 14 534 4.0E-13
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 151 389 4.0E-13
sp|C0M7S3|CH60_STRE4 60 kDa chaperonin OS=Streptococcus equi subsp. equi (strain 4047) GN=groL PE=3 SV=1 32 525 4.0E-13
sp|A0LR17|CH601_ACIC1 60 kDa chaperonin 1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=groL1 PE=3 SV=1 32 536 5.0E-13
sp|B4U081|CH60_STREM 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=groL PE=3 SV=1 32 525 5.0E-13
sp|Q8CXL3|CH60_OCEIH 60 kDa chaperonin OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=groL PE=3 SV=1 19 525 6.0E-13
sp|Q9AEP7|CH60_LACLM 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=groL PE=3 SV=1 32 525 6.0E-13
sp|Q031S8|CH60_LACLS 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=groL PE=3 SV=1 32 525 6.0E-13
sp|A9M0Q6|CH60_NEIM0 60 kDa chaperonin OS=Neisseria meningitidis serogroup C (strain 053442) GN=groL PE=3 SV=1 14 519 7.0E-13
sp|A6H125|CH60_FLAPJ 60 kDa chaperonin OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=groL PE=3 SV=1 32 516 1.0E-12
sp|Q0BHT1|CH601_BURCM 60 kDa chaperonin 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL1 PE=3 SV=1 18 519 1.0E-12
sp|A7MMC0|CH60_CROS8 60 kDa chaperonin OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=groL PE=3 SV=1 14 516 1.0E-12
sp|A8AZE1|CH60_STRGC 60 kDa chaperonin OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=groL PE=3 SV=1 32 523 1.0E-12
sp|P37282|CH60_LACLA 60 kDa chaperonin OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=groL PE=3 SV=2 32 525 1.0E-12
sp|O66192|CH60_KLUIN 60 kDa chaperonin (Fragment) OS=Kluyvera intermedia GN=groL PE=3 SV=1 14 534 1.0E-12
sp|O51832|CH60_BUCMP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Myzus persicae GN=groL PE=3 SV=1 14 516 1.0E-12
sp|Q8VT58|CH60_STRGN 60 kDa chaperonin OS=Streptococcus gordonii GN=groL PE=3 SV=1 32 523 1.0E-12
sp|B8D0Z4|CH60_HALOH 60 kDa chaperonin OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=groL PE=3 SV=1 31 526 1.0E-12
sp|Q5WJN4|CH60_BACSK 60 kDa chaperonin OS=Bacillus clausii (strain KSM-K16) GN=groL PE=3 SV=1 14 525 1.0E-12
sp|A1KW52|CH60_NEIMF 60 kDa chaperonin OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=groL PE=3 SV=1 14 519 1.0E-12
sp|P57006|CH60_NEIMA 60 kDa chaperonin OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=groL PE=3 SV=1 14 519 1.0E-12
sp|A0M7D9|CH60_GRAFK 60 kDa chaperonin OS=Gramella forsetii (strain KT0803) GN=groL PE=3 SV=1 32 516 1.0E-12
sp|P42385|CH60_NEIMB 60 kDa chaperonin OS=Neisseria meningitidis serogroup B (strain MC58) GN=groL PE=1 SV=2 14 519 2.0E-12
sp|B6IU98|CH60_RHOCS 60 kDa chaperonin OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=groL PE=3 SV=1 32 529 2.0E-12
sp|Q0ACQ9|CH60_ALKEH 60 kDa chaperonin OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=groL PE=3 SV=1 31 516 2.0E-12
sp|Q8KIX3|CH60_BUCTC 60 kDa chaperonin OS=Buchnera aphidicola subsp. Tetraneura caerulescens GN=groL PE=3 SV=1 14 516 2.0E-12
sp|A4JPD1|CH602_BURVG 60 kDa chaperonin 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL2 PE=3 SV=1 18 519 2.0E-12
sp|B3PLM6|CH60_CELJU 60 kDa chaperonin OS=Cellvibrio japonicus (strain Ueda107) GN=groL PE=3 SV=1 18 523 2.0E-12
sp|A7GIN3|CH60_CLOBL 60 kDa chaperonin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=groL PE=3 SV=1 18 158 2.0E-12
sp|B1IFD4|CH60_CLOBK 60 kDa chaperonin OS=Clostridium botulinum (strain Okra / Type B1) GN=groL PE=3 SV=1 18 158 2.0E-12
sp|C1FLV5|CH60_CLOBJ 60 kDa chaperonin OS=Clostridium botulinum (strain Kyoto / Type A2) GN=groL PE=3 SV=1 18 158 2.0E-12
sp|A5I723|CH60_CLOBH 60 kDa chaperonin OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=groL PE=3 SV=1 18 158 2.0E-12
sp|A7FYP3|CH60_CLOB1 60 kDa chaperonin OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=groL PE=3 SV=1 18 158 2.0E-12
sp|C3KUC8|CH60_CLOB6 60 kDa chaperonin OS=Clostridium botulinum (strain 657 / Type Ba4) GN=groL PE=3 SV=1 18 158 2.0E-12
sp|B1L1K0|CH60_CLOBM 60 kDa chaperonin OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=groL PE=3 SV=1 18 158 2.0E-12
sp|C4ZD46|CH60_EUBR3 60 kDa chaperonin OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=groL PE=3 SV=1 18 516 2.0E-12
sp|Q2NW94|CH60_SODGM 60 kDa chaperonin OS=Sodalis glossinidius (strain morsitans) GN=groL PE=1 SV=1 14 516 2.0E-12
sp|Q5QVT4|CH60_IDILO 60 kDa chaperonin OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=groL PE=3 SV=1 18 516 2.0E-12
sp|Q93N34|CH60_BUCRP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=groL PE=3 SV=1 14 516 3.0E-12
sp|Q8CX00|CH60_STRA5 60 kDa chaperonin OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=groL PE=3 SV=1 32 525 3.0E-12
sp|Q3JYQ0|CH60_STRA1 60 kDa chaperonin OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=groL PE=3 SV=1 32 525 3.0E-12
sp|Q9KNR7|CH601_VIBCH 60 kDa chaperonin 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=groL1 PE=3 SV=1 14 516 3.0E-12
sp|Q65MZ8|CH60_BACLD 60 kDa chaperonin OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=groL PE=3 SV=1 16 525 3.0E-12
sp|O66198|CH60_ENTAK 60 kDa chaperonin OS=Enterobacter aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) GN=groL PE=3 SV=2 14 516 3.0E-12
sp|A6TH53|CH60_KLEP7 60 kDa chaperonin OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=groL PE=3 SV=1 14 516 3.0E-12
sp|Q8KJ20|CH60_STRAP 60 kDa chaperonin OS=Streptococcus anginosus GN=groL PE=3 SV=1 32 523 3.0E-12
sp|A6T1E5|CH60_JANMA 60 kDa chaperonin OS=Janthinobacterium sp. (strain Marseille) GN=groL PE=3 SV=1 18 519 3.0E-12
sp|A5F4Y1|CH602_VIBC3 60 kDa chaperonin 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=groL2 PE=3 SV=1 14 516 3.0E-12
sp|Q8KIX4|CH60_BUCPP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Pterocomma populeum GN=groL PE=3 SV=1 14 516 4.0E-12
sp|B5Y368|CH60_KLEP3 60 kDa chaperonin OS=Klebsiella pneumoniae (strain 342) GN=groL PE=3 SV=1 14 516 4.0E-12
sp|A8G8S7|CH60_SERP5 60 kDa chaperonin OS=Serratia proteamaculans (strain 568) GN=groL PE=3 SV=1 14 516 4.0E-12
sp|Q8Y1P8|CH60_RALSO 60 kDa chaperonin OS=Ralstonia solanacearum (strain GMI1000) GN=groL PE=3 SV=1 18 519 4.0E-12
sp|Q9ZFD8|CH60_BURVI 60 kDa chaperonin OS=Burkholderia vietnamiensis GN=groL PE=3 SV=1 18 519 4.0E-12
sp|A4JC03|CH601_BURVG 60 kDa chaperonin 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL1 PE=3 SV=1 18 519 4.0E-12
sp|Q1LQS4|CH60_CUPMC 60 kDa chaperonin OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=groL PE=3 SV=1 18 519 4.0E-12
sp|P42384|CH602_MYCPA 60 kDa chaperonin 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=groL2 PE=3 SV=4 32 536 4.0E-12
sp|A0QLP6|CH602_MYCA1 60 kDa chaperonin 2 OS=Mycobacterium avium (strain 104) GN=groL2 PE=3 SV=1 32 536 4.0E-12
sp|Q9ZFE0|CH60_BURCE 60 kDa chaperonin OS=Burkholderia cepacia GN=groL PE=3 SV=1 18 519 4.0E-12
sp|P0C193|CH60_SODGL 60 kDa chaperonin OS=Sodalis glossinidius GN=groL PE=3 SV=1 14 516 4.0E-12
sp|Q7NQX1|CH602_CHRVO 60 kDa chaperonin 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL2 PE=3 SV=1 14 519 5.0E-12
sp|Q8CX22|CH60_STRA3 60 kDa chaperonin OS=Streptococcus agalactiae serotype III (strain NEM316) GN=groL PE=3 SV=1 32 525 5.0E-12
sp|Q2IKI2|CH601_ANADE 60 kDa chaperonin 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=groL1 PE=3 SV=1 15 529 5.0E-12
sp|B2T0I0|CH60_BURPP 60 kDa chaperonin OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=groL PE=3 SV=1 18 519 6.0E-12
sp|B2TIX0|CH60_CLOBB 60 kDa chaperonin OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=groL PE=3 SV=1 18 257 6.0E-12
sp|O66212|CH60_RAOPL 60 kDa chaperonin (Fragment) OS=Raoultella planticola GN=groL PE=3 SV=1 14 534 6.0E-12
sp|B4EXE2|CH60_PROMH 60 kDa chaperonin OS=Proteus mirabilis (strain HI4320) GN=groL PE=3 SV=1 32 523 7.0E-12
sp|Q8CWW6|CH60_STRMU 60 kDa chaperonin OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=groL PE=3 SV=1 21 523 7.0E-12
sp|B5R991|CH60_SALG2 60 kDa chaperonin OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=groL PE=3 SV=1 14 516 7.0E-12
sp|Q9AME7|CH60_STRAG 60 kDa chaperonin OS=Streptococcus agalactiae GN=groL PE=3 SV=1 32 525 8.0E-12
sp|Q144Q6|CH601_BURXL 60 kDa chaperonin 1 OS=Burkholderia xenovorans (strain LB400) GN=groL1 PE=3 SV=1 18 519 9.0E-12
sp|B4RRA1|CH60_NEIG2 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain NCCP11945) GN=groL PE=3 SV=1 14 519 9.0E-12
sp|A5FIV1|CH60_FLAJ1 60 kDa chaperonin OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=groL PE=3 SV=1 32 516 9.0E-12
sp|B5F2L0|CH60_SALA4 60 kDa chaperonin OS=Salmonella agona (strain SL483) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|P0A1D3|CH60_SALTY 60 kDa chaperonin OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=groL PE=3 SV=2 14 516 9.0E-12
sp|P0A1D4|CH60_SALTI 60 kDa chaperonin OS=Salmonella typhi GN=groL PE=3 SV=2 14 516 9.0E-12
sp|B4TSC6|CH60_SALSV 60 kDa chaperonin OS=Salmonella schwarzengrund (strain CVM19633) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B5BKF4|CH60_SALPK 60 kDa chaperonin OS=Salmonella paratyphi A (strain AKU_12601) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|C0Q6A2|CH60_SALPC 60 kDa chaperonin OS=Salmonella paratyphi C (strain RKS4594) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|A9N3Z7|CH60_SALPB 60 kDa chaperonin OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|Q5PL62|CH60_SALPA 60 kDa chaperonin OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B4TF80|CH60_SALHS 60 kDa chaperonin OS=Salmonella heidelberg (strain SL476) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B5R005|CH60_SALEP 60 kDa chaperonin OS=Salmonella enteritidis PT4 (strain P125109) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B5FRK2|CH60_SALDC 60 kDa chaperonin OS=Salmonella dublin (strain CT_02021853) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|Q57GP7|CH60_SALCH 60 kDa chaperonin OS=Salmonella choleraesuis (strain SC-B67) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|Q487Q9|CH60_COLP3 60 kDa chaperonin OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=groL PE=3 SV=1 18 516 9.0E-12
sp|Q5F541|CH60_NEIG1 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=groL PE=3 SV=1 14 519 9.0E-12
sp|Q3YUJ7|CH60_SHISS 60 kDa chaperonin OS=Shigella sonnei (strain Ss046) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|P0A6F8|CH60_SHIFL 60 kDa chaperonin OS=Shigella flexneri GN=groL PE=3 SV=2 14 516 9.0E-12
sp|Q0SXD6|CH60_SHIF8 60 kDa chaperonin OS=Shigella flexneri serotype 5b (strain 8401) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|Q328C4|CH60_SHIDS 60 kDa chaperonin OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|Q31T78|CH60_SHIBS 60 kDa chaperonin OS=Shigella boydii serotype 4 (strain Sb227) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B2TY18|CH60_SHIB3 60 kDa chaperonin OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|Q1R3B6|CH60_ECOUT 60 kDa chaperonin OS=Escherichia coli (strain UTI89 / UPEC) GN=groL PE=1 SV=1 14 516 9.0E-12
sp|B1LQG4|CH60_ECOSM 60 kDa chaperonin OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B6I615|CH60_ECOSE 60 kDa chaperonin OS=Escherichia coli (strain SE11) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B7NG81|CH60_ECOLU 60 kDa chaperonin OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|P0A6F5|CH60_ECOLI 60 kDa chaperonin OS=Escherichia coli (strain K12) GN=groL PE=1 SV=2 14 516 9.0E-12
sp|B1ITQ5|CH60_ECOLC 60 kDa chaperonin OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|P0A6F6|CH60_ECOL6 60 kDa chaperonin OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=groL PE=3 SV=2 14 516 9.0E-12
sp|Q0T9P8|CH60_ECOL5 60 kDa chaperonin OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|A8A7N9|CH60_ECOHS 60 kDa chaperonin OS=Escherichia coli O9:H4 (strain HS) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B1XDP7|CH60_ECODH 60 kDa chaperonin OS=Escherichia coli (strain K12 / DH10B) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|C5A1D5|CH60_ECOBW 60 kDa chaperonin OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=groL PE=1 SV=1 14 516 9.0E-12
sp|B7M8Q4|CH60_ECO8A 60 kDa chaperonin OS=Escherichia coli O8 (strain IAI1) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B7MSV9|CH60_ECO81 60 kDa chaperonin OS=Escherichia coli O81 (strain ED1a) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B7NTK2|CH60_ECO7I 60 kDa chaperonin OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B5Z2F2|CH60_ECO5E 60 kDa chaperonin OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|P0A6F7|CH60_ECO57 60 kDa chaperonin OS=Escherichia coli O157:H7 GN=groL PE=3 SV=2 14 516 9.0E-12
sp|B7LC02|CH60_ECO55 60 kDa chaperonin OS=Escherichia coli (strain 55989 / EAEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B7MKU8|CH60_ECO45 60 kDa chaperonin OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|B7UPW3|CH60_ECO27 60 kDa chaperonin OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|A7ZV12|CH60_ECO24 60 kDa chaperonin OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=groL PE=3 SV=1 14 516 9.0E-12
sp|A1AJ51|CH601_ECOK1 60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1 14 516 9.0E-12
sp|Q13ZW7|CH602_BURXL 60 kDa chaperonin 2 OS=Burkholderia xenovorans (strain LB400) GN=groL2 PE=3 SV=1 32 519 1.0E-11
sp|Q9ANR9|CH60_WIGBR 60 kDa chaperonin OS=Wigglesworthia glossinidia brevipalpis GN=groL PE=3 SV=1 14 516 1.0E-11
sp|O66026|CH60_KLEPN 60 kDa chaperonin OS=Klebsiella pneumoniae GN=groL PE=3 SV=1 14 516 1.0E-11
sp|Q9JI70|MKKS_MOUSE McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin OS=Mus musculus GN=Mkks PE=2 SV=2 35 415 1.0E-11
sp|A8AMQ6|CH60_CITK8 60 kDa chaperonin OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=groL PE=3 SV=1 14 516 1.0E-11
sp|Q0B1N7|CH603_BURCM 60 kDa chaperonin 3 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL3 PE=3 SV=1 32 519 1.0E-11
sp|P48219|CH60_YEREN 60 kDa chaperonin OS=Yersinia enterocolitica GN=groL PE=3 SV=1 14 516 1.0E-11
sp|B2UZ02|CH60_CLOBA 60 kDa chaperonin OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=groL PE=3 SV=1 18 244 1.0E-11
sp|B8F865|CH60_HAEPS 60 kDa chaperonin OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=groL PE=3 SV=1 14 530 1.0E-11
sp|A6LQ87|CH60_CLOB8 60 kDa chaperonin OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=groL PE=3 SV=1 32 242 1.0E-11
sp|O66196|CH60_LELAM 60 kDa chaperonin (Fragment) OS=Lelliottia amnigena GN=groL PE=3 SV=1 14 534 1.0E-11
sp|B0BPV1|CH60_ACTPJ 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=groL PE=3 SV=1 14 516 1.0E-11
sp|B3H1P4|CH60_ACTP7 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=groL PE=3 SV=1 14 516 1.0E-11
sp|B2GAI0|CH60_LACF3 60 kDa chaperonin OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=groL PE=3 SV=1 32 534 2.0E-11
sp|P31294|CH60_HAEDU 60 kDa chaperonin OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=groL PE=3 SV=2 14 516 2.0E-11
sp|Q5P7G2|CH60_AROAE 60 kDa chaperonin OS=Aromatoleum aromaticum (strain EbN1) GN=groL PE=3 SV=1 26 519 2.0E-11
sp|A9MFR9|CH60_SALAR 60 kDa chaperonin OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=groL PE=3 SV=1 14 516 2.0E-11
sp|P29842|CH60_NEIGO 60 kDa chaperonin OS=Neisseria gonorrhoeae GN=groL PE=1 SV=3 14 519 2.0E-11
sp|A1JIP3|CH60_YERE8 60 kDa chaperonin OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=groL PE=3 SV=1 14 516 2.0E-11
sp|P94166|CH60_ACTPL 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae GN=groL PE=3 SV=3 14 516 2.0E-11
sp|C5CPP8|CH60_VARPS 60 kDa chaperonin OS=Variovorax paradoxus (strain S110) GN=groL PE=3 SV=1 18 523 2.0E-11
sp|A3N120|CH60_ACTP2 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=groL PE=3 SV=1 14 516 2.0E-11
sp|P0C0N7|CH60_STAES 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=groL PE=3 SV=2 32 524 2.0E-11
sp|Q5HMZ1|CH60_STAEQ 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=groL PE=3 SV=1 32 524 2.0E-11
sp|O66194|CH60_PLUGE 60 kDa chaperonin (Fragment) OS=Pluralibacter gergoviae GN=groL PE=3 SV=1 14 516 3.0E-11
sp|P20110|CH601_RHOSH 60 kDa chaperonin 1 OS=Rhodobacter sphaeroides GN=groL1 PE=1 SV=4 32 525 3.0E-11
sp|Q3J419|CH601_RHOS4 60 kDa chaperonin 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL1 PE=3 SV=1 32 525 3.0E-11
sp|P0C0N6|CH60_STAEP 60 kDa chaperonin OS=Staphylococcus epidermidis GN=groL PE=3 SV=2 32 524 3.0E-11
sp|Q493W7|CH60_BLOPB 60 kDa chaperonin OS=Blochmannia pennsylvanicus (strain BPEN) GN=groL PE=3 SV=1 14 516 3.0E-11
sp|Q1GJ36|CH60_RUEST 60 kDa chaperonin OS=Ruegeria sp. (strain TM1040) GN=groL PE=3 SV=1 31 530 3.0E-11
sp|A4W5N8|CH60_ENT38 60 kDa chaperonin OS=Enterobacter sp. (strain 638) GN=groL PE=3 SV=1 14 516 3.0E-11
sp|A7MX54|CH60_VIBCB 60 kDa chaperonin OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=groL PE=3 SV=1 14 523 3.0E-11
sp|Q98IH9|CH602_RHILO 60 kDa chaperonin 2 OS=Rhizobium loti (strain MAFF303099) GN=groL2 PE=3 SV=1 32 529 3.0E-11
sp|A5UH48|CH60_HAEIG 60 kDa chaperonin OS=Haemophilus influenzae (strain PittGG) GN=groL PE=3 SV=1 14 516 3.0E-11
sp|B8GL19|CH60_THISH 60 kDa chaperonin OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=groL PE=3 SV=1 32 516 3.0E-11
sp|Q03MK3|CH60_STRTD 60 kDa chaperonin OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=groL PE=3 SV=1 31 525 3.0E-11
sp|Q5M670|CH60_STRT2 60 kDa chaperonin OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=groL PE=3 SV=1 31 525 3.0E-11
sp|Q5M1M9|CH60_STRT1 60 kDa chaperonin OS=Streptococcus thermophilus (strain CNRZ 1066) GN=groL PE=3 SV=1 31 525 3.0E-11
sp|Q7U348|CH60_BLOFL 60 kDa chaperonin OS=Blochmannia floridanus GN=groL PE=3 SV=1 14 516 4.0E-11
sp|P48215|CH60_NEIFL 60 kDa chaperonin OS=Neisseria flavescens GN=groL PE=3 SV=1 14 519 4.0E-11
sp|Q67KB8|CH60_SYMTH 60 kDa chaperonin OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=groL PE=3 SV=1 27 529 4.0E-11
sp|Q1WSW0|CH60_LACS1 60 kDa chaperonin OS=Lactobacillus salivarius (strain UCC118) GN=groL PE=3 SV=1 32 534 4.0E-11
sp|A1SXK4|CH602_PSYIN 60 kDa chaperonin 2 OS=Psychromonas ingrahamii (strain 37) GN=groL2 PE=3 SV=1 32 516 4.0E-11
sp|Q9XID0|FAB1D_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D OS=Arabidopsis thaliana GN=FAB1D PE=3 SV=1 176 402 4.0E-11
sp|Q9PFP2|CH60_XYLFA 60 kDa chaperonin OS=Xylella fastidiosa (strain 9a5c) GN=groL PE=3 SV=1 32 523 4.0E-11
sp|B9E899|CH60_MACCJ 60 kDa chaperonin OS=Macrococcus caseolyticus (strain JCSC5402) GN=groL PE=3 SV=1 19 523 4.0E-11
sp|B0USK6|CH60_HISS2 60 kDa chaperonin OS=Histophilus somni (strain 2336) GN=groL PE=3 SV=1 14 516 5.0E-11
sp|Q0I284|CH60_HAES1 60 kDa chaperonin OS=Haemophilus somnus (strain 129Pt) GN=groL PE=3 SV=1 14 516 5.0E-11
sp|Q7MBB2|CH60_MYCGA 60 kDa chaperonin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=groL PE=3 SV=2 32 513 5.0E-11
sp|Q87BC0|CH60_XYLFT 60 kDa chaperonin OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=groL PE=3 SV=1 32 523 5.0E-11
sp|B2I7D4|CH60_XYLF2 60 kDa chaperonin OS=Xylella fastidiosa (strain M23) GN=groL PE=3 SV=1 32 523 5.0E-11
sp|Q49YY5|CH60_STAS1 60 kDa chaperonin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=groL PE=3 SV=1 14 523 5.0E-11
sp|A1AST1|CH60_PELPD 60 kDa chaperonin OS=Pelobacter propionicus (strain DSM 2379) GN=groL PE=3 SV=1 16 525 5.0E-11
sp|P43733|CH60_HAEIN 60 kDa chaperonin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=groL PE=3 SV=1 14 516 6.0E-11
sp|B9DMM2|CH60_STACT 60 kDa chaperonin OS=Staphylococcus carnosus (strain TM300) GN=groL PE=3 SV=1 32 534 7.0E-11
sp|A5U9V2|CH60_HAEIE 60 kDa chaperonin OS=Haemophilus influenzae (strain PittEE) GN=groL PE=3 SV=1 14 516 7.0E-11
sp|Q3SMK1|CH60_THIDA 60 kDa chaperonin OS=Thiobacillus denitrificans (strain ATCC 25259) GN=groL PE=3 SV=1 14 519 7.0E-11
sp|A1WZJ2|CH60_HALHL 60 kDa chaperonin OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=groL PE=3 SV=1 32 523 8.0E-11
sp|P9WPE7|CH602_MYCTU 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=groEL2 PE=1 SV=1 32 529 8.0E-11
sp|P9WPE6|CH602_MYCTO 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=groEL2 PE=3 SV=1 32 529 8.0E-11
sp|P0A521|CH602_MYCBO 60 kDa chaperonin 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=groL2 PE=1 SV=2 32 529 8.0E-11
sp|A5TZG6|CH601_MYCTA 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=groL1 PE=3 SV=1 32 529 8.0E-11
sp|A1KFR2|CH601_MYCBP 60 kDa chaperonin 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=groL1 PE=3 SV=1 32 529 8.0E-11
sp|Q7MBB4|CH602_GLOVI 60 kDa chaperonin 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=groL2 PE=3 SV=1 16 536 9.0E-11
sp|Q9L7P5|CH601_VIBPA 60 kDa chaperonin 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=groL1 PE=3 SV=2 14 523 9.0E-11
sp|A3PID0|CH60_RHOS1 60 kDa chaperonin OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=groL PE=3 SV=1 32 525 9.0E-11
sp|A8F401|CH60_PSELT 60 kDa chaperonin OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=groL PE=3 SV=1 32 516 1.0E-10
sp|B2RKS6|CH60_PORG3 60 kDa chaperonin OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=groL PE=3 SV=1 32 526 1.0E-10
sp|Q7NT31|CH601_CHRVO 60 kDa chaperonin 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL1 PE=3 SV=1 32 519 1.0E-10
sp|P42375|CH60_PORGI 60 kDa chaperonin OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=groL PE=3 SV=2 32 526 1.0E-10
sp|A4J8H4|CH60_DESRM 60 kDa chaperonin OS=Desulfotomaculum reducens (strain MI-1) GN=groL PE=3 SV=1 15 528 1.0E-10
sp|Q6GF43|CH60_STAAR 60 kDa chaperonin OS=Staphylococcus aureus (strain MRSA252) GN=groL PE=3 SV=1 32 534 1.0E-10
sp|Q1BEF6|CH601_MYCSS 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain MCS) GN=groL1 PE=3 SV=2 32 536 1.0E-10
sp|A1UAH8|CH601_MYCSK 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain KMS) GN=groL1 PE=3 SV=1 32 536 1.0E-10
sp|A3PU33|CH601_MYCSJ 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain JLS) GN=groL1 PE=3 SV=1 32 536 1.0E-10
sp|A1B877|CH60_PARDP 60 kDa chaperonin OS=Paracoccus denitrificans (strain Pd 1222) GN=groL1 PE=3 SV=1 32 525 1.0E-10
sp|Q9Z462|CH60_PARDE 60 kDa chaperonin OS=Paracoccus denitrificans GN=groL PE=1 SV=2 32 525 1.0E-10
sp|Q4QN05|CH60_HAEI8 60 kDa chaperonin OS=Haemophilus influenzae (strain 86-028NP) GN=groL PE=3 SV=1 14 516 1.0E-10
sp|P63767|CH60_STAAW 60 kDa chaperonin OS=Staphylococcus aureus (strain MW2) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|Q6G7S8|CH60_STAAS 60 kDa chaperonin OS=Staphylococcus aureus (strain MSSA476) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|P99083|CH60_STAAN 60 kDa chaperonin OS=Staphylococcus aureus (strain N315) GN=groL PE=1 SV=1 32 534 2.0E-10
sp|P63766|CH60_STAAM 60 kDa chaperonin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|A5IUH6|CH60_STAA9 60 kDa chaperonin OS=Staphylococcus aureus (strain JH9) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|A6U3B5|CH60_STAA2 60 kDa chaperonin OS=Staphylococcus aureus (strain JH1) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|A7X4J1|CH60_STAA1 60 kDa chaperonin OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|Q59687|CH60_PASMU 60 kDa chaperonin OS=Pasteurella multocida (strain Pm70) GN=groL PE=3 SV=2 14 516 2.0E-10
sp|A8Z640|CH60_SULMW 60 kDa chaperonin OS=Sulcia muelleri (strain GWSS) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|Q0I885|CH601_SYNS3 60 kDa chaperonin 1 OS=Synechococcus sp. (strain CC9311) GN=groL1 PE=3 SV=1 32 525 2.0E-10
sp|Q6F8P6|CH60_ACIAD 60 kDa chaperonin OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=groL PE=3 SV=1 14 516 2.0E-10
sp|A8Z4T2|CH60_STAAT 60 kDa chaperonin OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|A6QIM7|CH60_STAAE 60 kDa chaperonin OS=Staphylococcus aureus (strain Newman) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|Q5HEH2|CH60_STAAC 60 kDa chaperonin OS=Staphylococcus aureus (strain COL) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|Q2FF95|CH60_STAA3 60 kDa chaperonin OS=Staphylococcus aureus (strain USA300) GN=groL PE=3 SV=1 32 534 2.0E-10
sp|Q38YR7|CH60_LACSS 60 kDa chaperonin OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=groL PE=3 SV=1 26 525 2.0E-10
sp|P48210|CH60_BORPE 60 kDa chaperonin OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=groL PE=3 SV=1 32 516 2.0E-10
sp|Q7W134|CH60_BORPA 60 kDa chaperonin OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=groL PE=3 SV=1 32 516 2.0E-10
sp|Q7WNS4|CH60_BORBR 60 kDa chaperonin OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=groL PE=3 SV=1 32 516 2.0E-10
sp|Q3J729|CH60_NITOC 60 kDa chaperonin OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=groL PE=3 SV=1 32 516 2.0E-10
sp|A0PNL7|CH602_MYCUA 60 kDa chaperonin 2 OS=Mycobacterium ulcerans (strain Agy99) GN=groL2 PE=3 SV=1 32 536 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2369
MQAPVLVMNTQSGDRQTGRRAQLSNIAAAKTVADIIRSCLGPKAMLKMLLDPMGGIVLTNDGHAILREIEVSHPA
AKSMIELSRTQDEEVGDGTTTVIILAGEILAQALPQLERSIHPVVIISAFKRALQDALEIIHQVSLPIDVNDDNA
MHKLISSSIGTKFVSRWMDLMCDLALKAVRTVTWEAGSGKTEVDIKRYARVEKVPGGEIEDSRVLDGVMLNKDIT
HPKMRRRIEKPRIVLLDCPLEYKKGESQTNIEISKEDDWNKILQIEEDQVKAMCEAILAVKPDLVITEKGVSDLA
QHFFIKANVTALRRVRKTDNNRIARATGATIVNRVEDIQESDVGTRCGLFEIEKIGDEYFSFLTKCQDAKACTVL
LRGPSKDVLNEIERNLQDAMGVARNVMFHPRLSPGGGATEMAVSVKLGQLAKGIEGVQQWPYKAVADAMEVIPRT
LVQNAGKSPVRVLTELRAKQAEGKSSWGVNGDSGTIVDMQEYGVWEPEAIKLQSIKTAVEAACLLLRVDDICSAK
KAKQGGMGGGDE*
Coding >OphauB2|2369
ATGCAGGCACCAGTGCTGGTCATGAACACCCAGAGTGGGGATAGACAGACGGGACGACGAGCTCAGCTATCCAAC
ATTGCTGCTGCCAAAACGGTCGCTGACATTATTCGATCATGTCTGGGTCCCAAGGCAATGCTCAAAATGCTCCTT
GATCCCATGGGCGGCATTGTCTTGACCAACGATGGGCACGCCATTCTGCGAGAGATTGAGGTCTCCCACCCAGCC
GCCAAGAGCATGATTGAGCTCAGCCGGACCCAAGACGAGGAAGTCGGCGACGGCACTACGACTGTCATCATTCTC
GCTGGCGAAATTCTGGCTCAGGCTCTCCCTCAGCTCGAGCGCAGTATCCATCCCGTCGTCATCATCTCGGCCTTT
AAGCGTGCCCTTCAAGACGCCCTCGAAATCATCCACCAAGTTTCTCTGCCCATTGATGTCAATGACGACAATGCC
ATGCATAAACTTATCTCGTCTTCCATTGGTACAAAATTCGTCTCGCGCTGGATGGACCTAATGTGTGACTTGGCC
CTCAAAGCTGTCCGAACCGTCACGTGGGAGGCTGGCAGTGGCAAAACCGAGGTTGATATCAAGCGATATGCGCGA
GTTGAAAAGGTGCCTGGCGGTGAAATTGAGGATAGCAGAGTCTTGGACGGTGTCATGCTCAACAAGGACATTACC
CACCCCAAAATGCGACGCCGCATTGAGAAACCGCGCATCGTCTTGCTCGACTGCCCCCTCGAGTACAAAAAGGGC
GAATCCCAGACAAATATCGAAATCTCAAAGGAGGATGATTGGAACAAGATTTTGCAAATCGAAGAGGATCAAGTC
AAGGCCATGTGTGAGGCCATTCTGGCCGTCAAACCAGACCTGGTCATTACCGAAAAGGGCGTGTCTGACTTGGCA
CAACATTTTTTTATCAAGGCCAACGTGACAGCACTACGCCGCGTGCGCAAGACGGACAACAACAGAATAGCACGA
GCCACGGGCGCCACCATTGTCAATCGGGTAGAGGATATCCAAGAGTCTGATGTGGGCACTAGGTGCGGCCTGTTC
GAGATTGAGAAGATTGGCGACGAGTATTTTAGCTTTCTCACCAAATGCCAAGACGCCAAGGCCTGTACGGTGCTG
CTCAGGGGACCATCAAAGGACGTGCTCAATGAAATCGAACGCAATCTTCAGGACGCAATGGGAGTGGCGCGCAAT
GTCATGTTCCATCCACGGCTATCTCCCGGTGGCGGCGCTACCGAAATGGCTGTCTCGGTCAAGTTGGGGCAGTTG
GCCAAGGGGATTGAAGGTGTTCAGCAGTGGCCGTACAAGGCAGTGGCTGACGCCATGGAGGTTATTCCGCGGACG
CTGGTGCAAAACGCTGGCAAGAGCCCGGTTCGGGTGCTGACGGAGCTGCGGGCCAAACAAGCTGAGGGTAAGAGC
TCGTGGGGGGTCAACGGGGATAGTGGCACCATTGTCGACATGCAGGAGTATGGGGTTTGGGAGCCGGAAGCCATC
AAGCTCCAGAGCATAAAGACGGCCGTCGAGGCTGCCTGCTTACTGCTTCGGGTCGATGACATTTGTAGCGCCAAA
AAGGCCAAACAAGGCGGCATGGGCGGAGGCGACGAATGA
Transcript >OphauB2|2369
ATGCAGGCACCAGTGCTGGTCATGAACACCCAGAGTGGGGATAGACAGACGGGACGACGAGCTCAGCTATCCAAC
ATTGCTGCTGCCAAAACGGTCGCTGACATTATTCGATCATGTCTGGGTCCCAAGGCAATGCTCAAAATGCTCCTT
GATCCCATGGGCGGCATTGTCTTGACCAACGATGGGCACGCCATTCTGCGAGAGATTGAGGTCTCCCACCCAGCC
GCCAAGAGCATGATTGAGCTCAGCCGGACCCAAGACGAGGAAGTCGGCGACGGCACTACGACTGTCATCATTCTC
GCTGGCGAAATTCTGGCTCAGGCTCTCCCTCAGCTCGAGCGCAGTATCCATCCCGTCGTCATCATCTCGGCCTTT
AAGCGTGCCCTTCAAGACGCCCTCGAAATCATCCACCAAGTTTCTCTGCCCATTGATGTCAATGACGACAATGCC
ATGCATAAACTTATCTCGTCTTCCATTGGTACAAAATTCGTCTCGCGCTGGATGGACCTAATGTGTGACTTGGCC
CTCAAAGCTGTCCGAACCGTCACGTGGGAGGCTGGCAGTGGCAAAACCGAGGTTGATATCAAGCGATATGCGCGA
GTTGAAAAGGTGCCTGGCGGTGAAATTGAGGATAGCAGAGTCTTGGACGGTGTCATGCTCAACAAGGACATTACC
CACCCCAAAATGCGACGCCGCATTGAGAAACCGCGCATCGTCTTGCTCGACTGCCCCCTCGAGTACAAAAAGGGC
GAATCCCAGACAAATATCGAAATCTCAAAGGAGGATGATTGGAACAAGATTTTGCAAATCGAAGAGGATCAAGTC
AAGGCCATGTGTGAGGCCATTCTGGCCGTCAAACCAGACCTGGTCATTACCGAAAAGGGCGTGTCTGACTTGGCA
CAACATTTTTTTATCAAGGCCAACGTGACAGCACTACGCCGCGTGCGCAAGACGGACAACAACAGAATAGCACGA
GCCACGGGCGCCACCATTGTCAATCGGGTAGAGGATATCCAAGAGTCTGATGTGGGCACTAGGTGCGGCCTGTTC
GAGATTGAGAAGATTGGCGACGAGTATTTTAGCTTTCTCACCAAATGCCAAGACGCCAAGGCCTGTACGGTGCTG
CTCAGGGGACCATCAAAGGACGTGCTCAATGAAATCGAACGCAATCTTCAGGACGCAATGGGAGTGGCGCGCAAT
GTCATGTTCCATCCACGGCTATCTCCCGGTGGCGGCGCTACCGAAATGGCTGTCTCGGTCAAGTTGGGGCAGTTG
GCCAAGGGGATTGAAGGTGTTCAGCAGTGGCCGTACAAGGCAGTGGCTGACGCCATGGAGGTTATTCCGCGGACG
CTGGTGCAAAACGCTGGCAAGAGCCCGGTTCGGGTGCTGACGGAGCTGCGGGCCAAACAAGCTGAGGGTAAGAGC
TCGTGGGGGGTCAACGGGGATAGTGGCACCATTGTCGACATGCAGGAGTATGGGGTTTGGGAGCCGGAAGCCATC
AAGCTCCAGAGCATAAAGACGGCCGTCGAGGCTGCCTGCTTACTGCTTCGGGTCGATGACATTTGTAGCGCCAAA
AAGGCCAAACAAGGCGGCATGGGCGGAGGCGACGAATGA
Gene >OphauB2|2369
ATGCAGGCACCAGTGCTGGTCATGAGTGAGCTTCAGCCAATCTCTCGCCTCGACTTTTCCGAGCTCTCGAGGCGT
GCGGCTCGGAGCTTGCCAACTGACGCGTATCATCGCAGACACCCAGAGTGGGGATAGACAGACGGGACGACGAGC
TCAGCTATCCAACATTGCTGCTGCCAAAACGTGCGATGCCCCGCCTGACCGCTTCTATACGTCTACTGACTTGCT
GGCGCCATTAGGGTCGCTGACATTATTCGATCATGTCTGGGTCCCAAGGCAATGCTCAAAATGCTCCTTGATCCC
ATGGGCGGCATTGTCTTGACCAACGATGGGCACGCCATTCTGCGAGAGATTGAGGTCTCCCACCCAGCCGCCAAG
AGCATGATTGAGCTCAGCCGGACCCAAGACGAGGAAGTCGGCGACGGCACTACGACTGTCATCATTCTCGGTATG
CCTCGGGCGCTCTTGTCTTTGCTATCTAGGCGCTTGCTAATCAAGGCGTCGTTGCAGCTGGCGAAATTCTGGCTC
AGGCTCTCCCTCAGCTCGAGCGCAGTATCCATCCCGTCGTCATCATCTCGGCCTTTAAGCGTGCCCTTCAAGACG
CCCTCGAAATCATCCACCAAGTTTCTCTGCCCATTGATGTCAATGACGACAATGCCATGCATAAACTTATCTCGT
CTTCCATTGGTACAAAATTCGTCTCGCGCTGGATGGACCTAATGTGTGACTTGGCCCTCAAAGCTGTCCGAACCG
TCACGTGGGAGGCTGGCAGTGGCAAAACCGAGGTTGATATCAAGCGATATGCGCGAGTTGAAAAGGTGCCTGGCG
GTGAAATTGAGGATAGCAGAGTCTTGGACGGTGTCATGCTCAACAAGGACATTACCCACCCCAAAATGCGACGCC
GCATTGAGAAACCGCGCATCGTCTTGCTCGACTGCCCCCTCGAGTACAAAAAGGGCGAATCCCAGACAAATATCG
AAATCTCAAAGGAGGATGATTGGAACAAGATTTTGCAAATCGAAGAGGATCAAGTCAAGGCCATGTGTGAGGCCA
TTCTGGCCGTCAAACCAGACCTGGTCATTACCGAAAAGGGCGTGTCTGGTGAGTAGTATGATGGGTACACGCTGG
ACTATTTGTGTTGGCTAATGCTTTTGCAGACTTGGCACAACATTTTTTTATCAAGGCCAACGTGACAGCACTACG
CCGCGTGCGCAAGACGGACAACAACAGAATAGCACGAGCCACGGGCGCCACCATTGTCAATCGGGTAGAGGATAT
CCAAGAGTCTGATGTGGGCACTAGGTGCGGCCTGTTCGAGATTGAGAAGATTGGCGACGAGTATTTTAGCTTTCT
CACCAAATGCCAAGACGCCAAGGCCTGTACGGTGCTGCTCAGGGGACCATCAAAGGACGTGCTCAATGAAATCGA
ACGCAATCTTCAGGACGCAATGGGAGTGGCGCGCAATGTCATGTTCCATCCACGGCTATCTCCCGGTGGCGGCGC
TACCGAAATGGCTGTCTCGGTCAAGTTGGGGCAGTTGGCCAAGGGGATTGAAGGTGTTCAGCAGTGGCCGTACAA
GGCAGTGGCTGACGCCATGGAGGTTATTCCGCGGACGCTGGTGCAAAACGCTGGCAAGAGCCCGGTTCGGGTGCT
GACGGAGCTGCGGGCCAAACAAGCTGAGGGTAAGAGCTCGTGGGGGGTCAACGGGGATAGTGGCACCATTGTCGA
CATGCAGGAGTATGGGGTTTGGGAGCCGGAAGCCATCAAGCTCCAGAGCATAAAGACGGCCGTCGAGGTAAGCTT
GGAGCGTGTAGACAAGAGGCGAATATGCTGCTGACATTTGGGTGACAATGGTTGACTAGGCTGCCTGCTTACTGC
TTCGGGTCGATGACATTTGTAGCGCCAAAAAGGCCAAACAAGGCGGCATGGGCGGAGGCGACGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail