Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2364
Gene name
LocationContig_172:21521..22326
Strand+
Gene length (bp)805
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 1.2E-15 76 201

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 70 92 22
3 111 130 19
4 145 167 22
5 187 205 18
6 215 232 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2364
MATNTSSPSGHGHSAVNTENEPLLGRPGDVNQARGAAICKNLIMGTAIVAQIGVIMAAAVVWGYILAKPLNLASG
HALVQSAAFFVLVQSILIQQPSRTAEQKHTGRQAHLLLNIIALLLLITGVVLIEYNKISAGNAHFHSVHAYLGVT
TLCIIAVQYLVGVTMWLTPRLYGGEERAKSVWKYHRWSGYFLLLLLGCTVSAAAVTDYIKLVLKVPTWPVILGSV
LVIVGVYPRIQKQKLGIASQ*
Coding >OphauB2|2364
ATGGCGACAAATACGTCGTCGCCCTCGGGCCATGGCCACTCCGCTGTCAACACCGAAAACGAACCACTTCTTGGA
CGCCCTGGAGACGTCAACCAAGCCCGAGGCGCTGCCATCTGTAAGAATCTCATCATGGGTACCGCCATTGTGGCC
CAGATCGGCGTCATCATGGCCGCCGCTGTCGTTTGGGGTTACATCTTGGCCAAGCCGCTCAATCTCGCCTCAGGC
CACGCCTTGGTCCAGTCTGCAGCATTTTTCGTTCTGGTGCAGAGCATATTGATCCAGCAGCCCAGTCGCACTGCA
GAACAGAAGCATACCGGCCGACAGGCTCACCTGCTCTTGAACATTATTGCTCTGCTGCTGCTTATTACTGGCGTT
GTCCTCATTGAGTACAATAAGATTTCTGCTGGCAATGCCCACTTCCACTCGGTCCACGCCTATCTTGGCGTCACC
ACCCTCTGCATCATCGCCGTCCAGTACTTGGTCGGCGTCACCATGTGGCTTACTCCGCGCCTTTACGGAGGCGAA
GAGCGTGCAAAATCTGTCTGGAAGTACCATCGTTGGTCGGGCTACTTTCTGTTGCTCCTTCTCGGCTGCACCGTC
TCAGCTGCCGCCGTAACCGACTACATTAAATTGGTGCTCAAAGTCCCGACTTGGCCCGTCATTCTCGGTTCCGTC
TTGGTCATTGTCGGGGTCTACCCTCGTATCCAGAAGCAAAAACTCGGCATCGCCAGCCAGTAG
Transcript >OphauB2|2364
ATGGCGACAAATACGTCGTCGCCCTCGGGCCATGGCCACTCCGCTGTCAACACCGAAAACGAACCACTTCTTGGA
CGCCCTGGAGACGTCAACCAAGCCCGAGGCGCTGCCATCTGTAAGAATCTCATCATGGGTACCGCCATTGTGGCC
CAGATCGGCGTCATCATGGCCGCCGCTGTCGTTTGGGGTTACATCTTGGCCAAGCCGCTCAATCTCGCCTCAGGC
CACGCCTTGGTCCAGTCTGCAGCATTTTTCGTTCTGGTGCAGAGCATATTGATCCAGCAGCCCAGTCGCACTGCA
GAACAGAAGCATACCGGCCGACAGGCTCACCTGCTCTTGAACATTATTGCTCTGCTGCTGCTTATTACTGGCGTT
GTCCTCATTGAGTACAATAAGATTTCTGCTGGCAATGCCCACTTCCACTCGGTCCACGCCTATCTTGGCGTCACC
ACCCTCTGCATCATCGCCGTCCAGTACTTGGTCGGCGTCACCATGTGGCTTACTCCGCGCCTTTACGGAGGCGAA
GAGCGTGCAAAATCTGTCTGGAAGTACCATCGTTGGTCGGGCTACTTTCTGTTGCTCCTTCTCGGCTGCACCGTC
TCAGCTGCCGCCGTAACCGACTACATTAAATTGGTGCTCAAAGTCCCGACTTGGCCCGTCATTCTCGGTTCCGTC
TTGGTCATTGTCGGGGTCTACCCTCGTATCCAGAAGCAAAAACTCGGCATCGCCAGCCAGTAG
Gene >OphauB2|2364
ATGGCGACAAATACGTCGTCGCCCTCGGGCCATGGCCACTCCGCTGTCAACACCGAAAACGAACCACTTCTTGGA
CGCCCTGGAGACGTCAACCAAGCCCGAGGCGCTGCCATCTGTAAGAATCTCATCATGGGTAAGAATCTCGTCTGC
ACCTCTCGGCTACACGCTCTTTTGTTGATGTGTCGATGCGTCGCCCCCAGGTACCGCCATTGTGGCCCAGATCGG
CGTCATCATGGCCGCCGCTGTCGTTTGGGGTTACATCTTGGCCAAGCCGCTCAATCTCGCCTCAGGCCACGCCTT
GGTCCAGTCTGCAGCATTTTTCGTTCTGGTGCAGAGCATATTGATCCAGCAGCCCAGTCGCACTGCAGAACAGAA
GCATACCGGCCGACAGGCTCACCTGCTCTTGAACATTATTGCTCTGCTGCTGCTTATTACTGGCGTTGTCCTCAT
TGAGTACAATAAGATTTCTGCTGGCAATGCCCACTTCCACTCGGTCCACGCCTATCTTGGCGTCACCACCCTCTG
CATCATCGCCGTCCAGTACTTGGTCGGCGTCACCATGTGGCTTACTCCGCGCCTTTACGGAGGCGAAGAGCGTGC
AAAATCTGTCTGGAAGTACCATCGTTGGTCGGGCTACTTTCTGTTGCTCCTTCTCGGCTGCACCGTCTCAGCTGC
CGCCGTAACCGACTACATTAAATTGGTGCTCAAAGTCCCGACTTGGCCCGTCATTCTCGGTTCCGTCTTGGTCAT
TGTCGGGGTCTACCCTCGTATCCAGAAGCAAAAACTCGGCATCGCCAGCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail